Recombinant Salmonella paratyphi B Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; SPAB_00683; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
arnC
Target Protein Sequence
MFDAAPIKKVSVVIPVYNEQESLPELIRRTTTACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTSFTEESHQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxin and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of ArnC in Salmonella paratyphi B?

ArnC (Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase) is an integral membrane glycosyltransferase that catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) from UDP to undecaprenyl phosphate. This reaction is critical in the lipopolysaccharide (LPS) modification pathway that leads to polymyxin resistance in Gram-negative bacteria.

The specific biochemical reaction catalyzed by ArnC is:

UDP-4-deoxy-4-formamido-β-L-arabinose + di-trans,octa-cis-undecaprenyl phosphate → UDP + 4-deoxy-4-formamido-α-L-arabinose di-trans,octa-cis-undecaprenyl phosphate

This modified product is subsequently deformylated by ArnD, flipped to the outer leaflet of the inner membrane by ArnE/F, and finally transferred to lipid A by ArnT, thereby reducing the negative charge of the bacterial membrane and decreasing the binding affinity of positively charged antimicrobial peptides like polymyxins .

How do ArnC proteins differ between Salmonella subspecies?

Comparison of ArnC sequences across different Salmonella species and subspecies reveals high conservation with subtle variations that may affect function or regulatory properties:

SpeciesProtein LengthUniProt IDKey Sequence Features
S. paratyphi B327 aaA9N5B3Position 184: G (Glycine)
S. paratyphi C327 aaC0Q070Position 184: S (Serine)
E. coli HS328 aaA8A2C1Contains additional conserved domains

These differences, though minor, may influence substrate specificity, catalytic efficiency, or membrane integration. While the functional significance of these specific amino acid variations has not been fully characterized, the high degree of conservation reflects the evolutionary importance of this enzyme in bacterial survival mechanisms .

What is the proposed catalytic mechanism of ArnC?

Based on structural studies using cryo-electron microscopy and molecular dynamics simulations, a detailed catalytic mechanism for ArnC has been proposed:

  • The acceptor lipid (undecaprenyl phosphate or UndP) threads between the juxtamembrane helices of ArnC to reach the catalytic GT-A domain.

  • UndP initially adopts a "standby" position (P1) within the GT-A domain before transitioning to a "catalysis" position (P2).

  • The first aspartate in the DXD motif functions as a catalytic base, abstracting a proton from UndP to activate it for nucleophilic attack.

  • The activated UndP performs a nucleophilic attack on the C1 carbon of the Ara4FN sugar in UDP-L-Ara4FN.

  • This forms a glycosidic bond between UndP and Ara4FN, with the concurrent release of UDP.

The reaction requires Mn²⁺ as a cofactor, which facilitates higher-affinity binding of the donor substrate. Upon UDP binding, ArnC undergoes a conformational change characterized by a clamshell-like motion that brings the GT-A domain closer to the juxtamembrane helices, creating the optimal configuration for catalysis .

How do conformational changes affect ArnC function?

Structural studies have revealed that ArnC undergoes significant conformational changes during its catalytic cycle:

  • In the apo state, the enzyme adopts a more open conformation.

  • Upon binding of UDP (and presumably the full donor substrate UDP-L-Ara4FN), ArnC undergoes a clamshell-like motion that brings the GT-A domain closer to the juxtamembrane helices.

  • This conformational change is essential for:

    • Proper positioning of catalytic residues

    • Coordination of the Mn²⁺ cofactor

    • Creation of the binding pocket for UndP

    • Facilitating the nucleophilic attack mechanism

Coarse-grained and atomistic simulations have further elucidated how the lipid substrate (UndP) threads between the juxtamembrane helices to reach the catalytic site. These conformational dynamics are crucial for understanding substrate recognition and the catalytic mechanism .

How does ArnC contribute to polymyxin resistance mechanisms in Salmonella paratyphi B?

ArnC plays a critical role in the aminoarabinose biosynthetic pathway that modifies lipid A, leading to polymyxin resistance through several mechanisms:

  • The addition of aminoarabinose to lipid A reduces the negative charge of the bacterial outer membrane.

  • This charge reduction decreases the electrostatic attraction between the positively charged polymyxins and the bacterial surface.

  • The modified lipid A exhibits reduced binding affinity for polymyxins, preventing their membrane insertion and subsequent bactericidal effects.

  • The arnC gene is part of the arn operon, which is upregulated in response to environmental signals typically encountered during infection, such as low Mg²⁺ concentrations or acidic pH.

  • Genomic studies of Salmonella paratyphi B strains have identified distinct patterns of virulence gene expression, including those involved in antimicrobial resistance mechanisms like the arn pathway.

This modification pathway is particularly significant as polymyxins (including colistin) are often used as last-resort antibiotics for multidrug-resistant Gram-negative infections .

What are the optimal conditions for expressing and purifying recombinant Salmonella paratyphi B ArnC?

Based on published protocols and commercial recombinant protein specifications, the following conditions are recommended for recombinant ArnC expression and purification:

Expression System:

  • Host: E. coli (BL21 or similar strains)

  • Vector: pET or similar with an N-terminal His-tag

  • Induction: IPTG (0.5-1.0 mM) at mid-log phase

  • Temperature: Reduce to 18-20°C after induction for proper membrane protein folding

Purification Protocol:

  • Cell lysis: Mechanical disruption via sonication or high-pressure homogenization

  • Membrane isolation: Ultracentrifugation (100,000 × g, 1 hour)

  • Solubilization: Mild detergents (DDM, LMNG) in Tris/PBS buffer (pH 8.0)

  • Affinity purification: Ni-NTA chromatography using the N-terminal His-tag

  • Size exclusion: Further purification and assessment of oligomeric state

Storage Conditions:

  • Buffer: Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • Storage: -20°C/-80°C with aliquoting to avoid freeze-thaw cycles

  • Reconstitution: Deionized sterile water to 0.1-1.0 mg/mL

  • Stability: Addition of 5-50% glycerol for long-term storage

For structural studies, reconstitution in nanodiscs has proven successful, maintaining the protein in a lipid environment that better mimics its native membrane context .

How can I design effective assays to measure ArnC enzymatic activity?

Several complementary approaches can be used to measure ArnC activity with varying degrees of complexity and information output:

1. Radioisotope-Based Assay:

  • Substrate: Radiolabeled UDP-L-Ara4FN (¹⁴C or ³H labeled)

  • Detection: Separation by thin-layer chromatography followed by scintillation counting

  • Advantages: High sensitivity and direct measurement of product formation

  • Limitations: Requires specialized facilities for handling radioactive materials

2. Coupled Enzyme Assay:

  • Principle: Monitor UDP release during the reaction

  • Coupling enzymes: UDP-glucose pyrophosphorylase and glucose-6-phosphate dehydrogenase

  • Detection: Spectrophotometric measurement of NADPH formation at 340 nm

  • Advantages: Continuous readout and no radioactivity

  • Limitations: Potential interference from coupling enzymes

3. Mass Spectrometry-Based Assay:

  • Approach: Direct detection of UndP-L-Ara4FN product by LC-MS/MS

  • Sample preparation: Lipid extraction followed by chromatographic separation

  • Advantages: Provides structural confirmation of the product

  • Limitations: Requires specialized equipment and expertise

4. Assay Optimization Considerations:

  • Buffer composition: Typically Tris or HEPES buffer, pH 7.5-8.0

  • Divalent cations: Mn²⁺ (1-5 mM) is required for activity

  • Detergent: Mild non-ionic detergents needed for membrane protein stability

  • Controls: Include enzyme-free and substrate-free controls

For all assays, it's crucial to include appropriate controls and validate the activity of the recombinant enzyme using multiple methods .

What methodological approaches are used to study ArnC structure-function relationships?

Multiple complementary techniques have been employed to elucidate ArnC structure-function relationships:

1. Structural Biology Approaches:

  • Cryo-electron microscopy: Successfully used to determine ArnC structures in different conformational states

  • X-ray crystallography: Challenging for membrane proteins but potentially provides high-resolution structures

  • NMR spectroscopy: Useful for studying dynamic regions and ligand interactions

2. Computational Methods:

  • Molecular dynamics simulations: Both coarse-grained and atomistic simulations have been used to model substrate interactions

  • Homology modeling: For comparative analysis of ArnC across different bacterial species

  • Docking studies: To predict binding modes of substrates and potential inhibitors

3. Functional Characterization:

  • Site-directed mutagenesis: To identify catalytically important residues

  • Chimeric proteins: To determine domain-specific functions

  • Fluorescence-based approaches: For studying protein-lipid interactions

4. Biophysical Techniques:

  • Microscale Thermophoresis (MST): Used to demonstrate that Mn²⁺ enables higher affinity binding of UDP

  • Circular Dichroism (CD): For secondary structure analysis

  • Thermal stability assays: To assess protein folding and stability

Recent structural studies of ArnC have combined cryo-EM with molecular simulations to provide insights into the conformational changes associated with substrate binding and catalysis .

How can I design experiments to analyze the role of ArnC in antimicrobial resistance?

To investigate ArnC's role in antimicrobial resistance, consider these experimental approaches:

1. Genetic Manipulation Strategies:

  • Gene knockout: Create ΔarnC strains to assess the specific contribution to resistance

  • Complementation studies: Reintroduce wild-type or mutant arnC to confirm phenotypes

  • Controlled expression systems: Modulate ArnC levels to determine dose-dependent effects

2. Phenotypic Characterization:

  • Antimicrobial susceptibility testing: Determine MICs for polymyxins and other cationic antimicrobial peptides

  • Time-kill kinetics: Assess the dynamics of bacterial killing in the presence of antimicrobials

  • Population analysis profiles: Identify heteroresistant subpopulations

3. Biochemical Analysis:

  • Lipid A structural analysis: Mass spectrometry to detect aminoarabinose modifications

  • Membrane charge assessment: Cytochrome C binding assay to measure surface charge

  • Outer membrane integrity tests: NPN uptake assay or membrane permeabilization studies

4. Microscopy and Imaging:

  • Electron microscopy: Visualize membrane ultrastructure

  • Fluorescence microscopy: Using labeled polymyxins to assess binding to the bacterial surface

  • Atomic force microscopy: Evaluate membrane physical properties

5. Transcriptional Analysis:

  • qRT-PCR: Measure expression of arnC and related genes under different conditions

  • RNA-seq: Global transcriptional response to antimicrobial exposure

  • Reporter fusions: Monitor arnC promoter activity in real-time

This multi-faceted approach allows for comprehensive assessment of ArnC's role in antimicrobial resistance mechanisms .

How can I resolve contradictory results when measuring ArnC activity from different experimental approaches?

When encountering contradictory results in ArnC studies, consider this systematic troubleshooting approach:

1. Sample Preparation Factors:

  • Protein quality: Verify enzyme purity by SDS-PAGE and assess activity using known controls

  • Membrane environment: ArnC requires appropriate lipid/detergent environments for activity

  • Substrate integrity: Confirm UDP-L-Ara4FN and UndP quality by analytical methods

  • Buffer conditions: Test multiple pH values (7.0-8.5) and salt concentrations

2. Methodological Validation:

  • Assay specificity: Validate each assay using inactive mutants (e.g., DXD motif mutations)

  • Kinetic parameters: Compare Km and Vmax values across different assay methods

  • Detection limits: Determine sensitivity thresholds for each analytical technique

  • Interfering factors: Identify components that might affect specific assay readouts

3. Experimental Design Considerations:

  • Time course studies: Establish optimal reaction times to ensure linearity

  • Enzyme concentration series: Verify proportional relationship between protein amount and activity

  • Temperature effects: Assess activity at different temperatures (20-37°C)

  • Cofactor requirements: Optimize Mn²⁺ concentration for maximal activity

4. Data Analysis Approaches:

  • Statistical methods: Apply appropriate statistical tests based on data distribution

  • Outlier analysis: Use Grubbs' test or similar to identify true outliers

  • Normalization strategies: Consider different reference points for activity comparison

  • Batch effects: Account for variation between protein preparations or reagent lots

When reporting seemingly contradictory results, clearly document all experimental conditions to facilitate interpretation and reproducibility .

What statistical methods are most appropriate for analyzing ArnC catalytic activity data?

Appropriate statistical analysis of ArnC enzymatic data requires consideration of the specific experimental design and data characteristics:

1. Enzyme Kinetics Analysis:

ParameterMethodApplication
Km, VmaxNon-linear regressionDirect fitting to Michaelis-Menten equation
Linearity assessmentR² and residual analysisEnsuring validity of kinetic models
Inhibition constantsVarious inhibition modelsCharacterizing competitive vs. non-competitive inhibition
Catalytic efficiencykcat/Km calculationComparing substrate preferences

2. Experimental Design Considerations:

  • Technical replicates: Minimum of 3-5 replicates per condition

  • Biological replicates: Independent protein preparations (≥3)

  • Control samples: Negative and positive controls in each experiment

  • Randomization: Minimize systematic errors from equipment or reagent degradation

3. Statistical Tests for Hypothesis Testing:

  • Parametric tests: t-test (two conditions) or ANOVA (multiple conditions) for normally distributed data

  • Non-parametric alternatives: Mann-Whitney U test or Kruskal-Wallis test

  • Multiple comparison corrections: Bonferroni, Tukey, or false discovery rate methods

  • Power analysis: Determine sample size needed for desired statistical power

4. Advanced Analytical Approaches:

  • Global fitting of multiple datasets: When analyzing complex reaction mechanisms

  • Bayesian methods: For incorporating prior knowledge about enzyme behavior

  • Bootstrap analysis: For robust confidence interval estimation

  • Principal component analysis: For identifying patterns in multivariate data

These statistical approaches should be selected based on the specific experimental questions and the nature of the data collected .

How should I interpret changes in ArnC expression in response to environmental stressors?

Changes in ArnC expression in response to environmental conditions provide insights into bacterial adaptation mechanisms. When interpreting such changes:

1. Regulatory Context:

  • ArnC expression is regulated by two-component systems including PmrA/PmrB and PhoP/PhoQ

  • These systems respond to specific environmental signals:

    • Low Mg²⁺ concentrations (activates PhoP/PhoQ)

    • Acidic pH (activates PmrA/PmrB)

    • Presence of antimicrobial peptides

    • Iron limitation

2. Expression Pattern Analysis:

  • Temporal dynamics: Immediate vs. delayed responses indicate direct or indirect regulation

  • Dose-dependency: Threshold effects may suggest regulatory switches

  • Co-expression patterns: Coordinate regulation with other arn genes indicates operon structure

3. Functional Implications:

  • Increased expression typically correlates with enhanced polymyxin resistance

  • Changes should be confirmed at protein level (Western blot) and activity level

  • Expression changes may not translate linearly to resistance levels due to rate-limiting steps

4. Strain-Specific Considerations:

  • Different Salmonella paratyphi B strains may show varying baseline expression levels

  • Clinical isolates often exhibit higher constitutive expression than laboratory strains

  • Historical isolates may differ from contemporary strains due to evolutionary pressures

Upregulation of ArnC in response to environmental stressors generally indicates activation of defense mechanisms that could contribute to antimicrobial resistance during infection .

What approaches should I use to compare ArnC function between Salmonella paratyphi B and other bacterial pathogens?

For rigorous comparative analysis of ArnC across bacterial species, employ these methodological approaches:

1. Sequence and Structural Comparison:

  • Multiple sequence alignment to identify conserved catalytic residues and variable regions

  • Phylogenetic analysis to establish evolutionary relationships

  • Homology modeling based on available structures

  • Analysis of protein surface properties and electrostatic potentials

2. Expression Analysis:

  • Standardized qRT-PCR protocols with validated reference genes

  • Western blot with epitope-tagged constructs if antibodies are limiting

  • Promoter-reporter fusions to assess transcriptional regulation

  • RNA-seq for global expression patterns under identical conditions

3. Functional Characterization:

  • Standardized enzymatic assays under identical conditions

  • Determination of kinetic parameters for different orthologs

  • Substrate specificity profiles using modified substrates

  • Complementation studies in knockout strains

4. Antimicrobial Resistance Profiling:

  • MIC determination using standardized methods (CLSI or EUCAST)

  • Time-kill kinetics with various antimicrobial peptides

  • Population analysis profiles to detect heteroresistance

  • Competition assays to assess fitness costs of resistance

5. Genomic Context Analysis:

  • Operon structure and gene synteny

  • Mobile genetic elements associated with arnC

  • Regulatory elements and binding sites for transcription factors

  • Associated virulence factors or pathogenicity islands

This multi-faceted comparative approach can reveal species-specific adaptations and conserved mechanisms of antimicrobial resistance mediated by ArnC .

What are emerging approaches for targeting ArnC to combat antimicrobial resistance?

ArnC represents a promising target for combating polymyxin resistance in Gram-negative pathogens through several innovative approaches:

1. Structure-Based Inhibitor Design:

  • Rational design based on recent structural insights

  • Virtual screening of compound libraries against the catalytic site

  • Fragment-based approaches to identify binding site hotspots

  • Development of transition state analogs that mimic the catalytic intermediate

2. Combination Therapy Strategies:

  • ArnC inhibitors as adjuvants to restore polymyxin sensitivity

  • Multi-target approaches affecting multiple enzymes in the aminoarabinose pathway

  • Permeabilizers to enhance uptake of ArnC inhibitors across the bacterial membrane

  • Efflux pump inhibitors to prevent export of potential inhibitors

3. Innovative Screening Approaches:

  • Whole-cell phenotypic screens for polymyxin sensitization

  • Target-based biochemical assays with purified components

  • Reporter systems to monitor arn operon expression

  • Bacterial cytological profiling to identify inhibitors with specific mechanisms

4. Alternative Modulation Strategies:

  • RNA-based approaches (antisense, CRISPR interference) to reduce expression

  • Engineered phages targeting bacteria with active aminoarabinose modification

  • Allosteric modulators affecting protein dynamics rather than the active site

  • Disruption of protein-protein interactions in the aminoarabinose biosynthetic pathway

The development of ArnC inhibitors could provide valuable adjuvants to extend the clinical utility of polymyxins against resistant Gram-negative pathogens like multidrug-resistant Salmonella paratyphi B .

What research questions remain unexplored regarding ArnC in Salmonella paratyphi B?

Despite recent advances, several critical aspects of ArnC biology remain unexplored:

1. Structural and Functional Dynamics:

  • Complete characterization of the full catalytic cycle

  • Identification of intermediate conformational states

  • Role of specific lipid environments in modulating activity

  • Potential oligomerization and its functional significance

2. Regulatory Mechanisms:

  • Post-translational modifications affecting ArnC activity

  • Small molecule regulators of ArnC function

  • Feedback mechanisms within the aminoarabinose pathway

  • Integration with other cell envelope stress responses

3. Host-Pathogen Interactions:

  • Impact of host antimicrobial peptides on ArnC expression

  • ArnC-mediated modifications affecting immune recognition

  • Evolution of ArnC in response to therapeutic pressures

  • Contribution to Salmonella paratyphi B virulence and persistence

4. Clinical and Epidemiological Aspects:

  • Correlation between ArnC polymorphisms and clinical outcomes

  • Geographic distribution of ArnC variants in Salmonella paratyphi B

  • Emergence of hypervirulent strains with enhanced ArnC activity

  • Transmission dynamics of strains with modified ArnC function

5. Technological Developments:

  • Development of ArnC-specific antibodies for diagnostic applications

  • High-throughput assays for large-scale screening campaigns

  • Synthetic biology approaches to engineer ArnC variants

  • Novel imaging techniques to visualize ArnC localization and dynamics

Addressing these knowledge gaps could significantly advance our understanding of bacterial antimicrobial resistance mechanisms and inform the development of novel therapeutic strategies .

How does ArnC function integrate with broader antimicrobial resistance mechanisms in Salmonella paratyphi B?

ArnC functions within a complex network of resistance mechanisms that collectively enhance Salmonella paratyphi B survival during antimicrobial exposure:

1. Coordinated Envelope Modifications:

  • ArnC-mediated aminoarabinose addition works synergistically with:

    • PagP-mediated palmitate addition to lipid A

    • PmrC-mediated phosphoethanolamine modification

    • LpxO-mediated hydroxylation of lipid A

  • These modifications collectively reduce membrane permeability to antimicrobials

2. Regulatory Network Integration:

  • ArnC expression is coordinated with other resistance mechanisms through:

    • Two-component systems (PhoP/PhoQ, PmrA/PmrB)

    • Stress response regulators (RpoS, RpoE)

    • Quorum sensing systems

    • Small regulatory RNAs (MicA, RybB)

3. Adaptive Resistance Phenotypes:

  • ArnC contribution to heteroresistance populations

  • Cross-resistance between polymyxins and other antimicrobial classes

  • Persistence mechanisms that depend on envelope modifications

  • Biofilm formation enhanced by LPS modifications

4. Evolutionary Considerations:

  • Horizontal gene transfer of resistance elements

  • Compensatory mutations that reduce fitness costs

  • Selection pressures from clinical and agricultural antimicrobial use

  • Environmental reservoirs maintaining resistance genes

5. Clinical and Epidemiological Impacts:

  • Emergence of multi-resistant Salmonella paratyphi B strains

  • Treatment failures associated with polymyxin resistance

  • Geographical variation in resistance patterns

  • Host-specific adaptation of resistance mechanisms

Understanding these integrated resistance networks is essential for developing comprehensive strategies to combat antimicrobial resistance in Salmonella paratyphi B and related pathogens .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.