Recombinant Salmonella paratyphi B UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqhA; SPAB_03936; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
yqhA
Target Protein Sequence
MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for recombinant YqhA production?

Multiple expression systems can be employed for YqhA production, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliBest yields, shorter turnaround times, cost-effectiveMay lack post-translational modifications
YeastGood yields, some post-translational modificationsMore complex than E. coli systems
Insect cells with baculovirusMany post-translational modificationsLonger production time, more technically demanding
Mammalian cellsMost complete post-translational modificationsLowest yields, highest cost, longest timelines

What are the recommended storage and handling protocols for recombinant YqhA?

Optimal storage and handling protocols for maintaining YqhA stability and activity include:

  • Long-term storage: Store lyophilized protein at -20°C/-80°C

  • Reconstitution: Briefly centrifuge vial before opening, then reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Stabilization: Add glycerol to 5-50% final concentration (50% is standard)

  • Aliquoting: Divide into working aliquots to avoid repeated freeze-thaw cycles

  • Working stock: Store working aliquots at 4°C for up to one week

  • Buffer conditions: Tris/PBS-based buffer with 6% trehalose, pH 8.0

Repeated freeze-thaw cycles significantly reduce protein stability and activity, making proper aliquoting essential for long-term experimental reproducibility .

How can researchers verify the purity and integrity of recombinant YqhA preparations?

Verification of YqhA purity and integrity should follow a multi-method approach:

  • SDS-PAGE analysis: Should demonstrate >90% purity with a prominent band at the expected molecular weight

  • Western blot: Using anti-His tag antibodies to confirm identity

  • Mass spectrometry: For precise molecular weight determination and sequence verification

  • Circular dichroism: To assess secondary structure integrity

  • Size exclusion chromatography: To evaluate homogeneity and detect aggregation

Researchers should establish quality control benchmarks at the outset of their studies to ensure experimental reproducibility across different protein preparations.

What are the structural similarities and differences between YqhA from Salmonella paratyphi B and other Salmonella strains?

Comparative analysis reveals high sequence conservation between YqhA proteins across Salmonella strains:

StrainUniProt IDSequence Identity to S. paratyphi BKey Differences
S. paratyphi BA9N4W6100%Reference sequence
S. paratyphi AB5BFW599.4%Conservative substitutions in transmembrane domains
S. typhimuriumVarious~98%Minor variations in C-terminal region

The high conservation suggests critical functional importance across Salmonella species. Researchers can leverage this conservation for cross-species studies, but should be aware of the subtle differences when interpreting experimental results .

What experimental designs are most appropriate for investigating YqhA function in Salmonella pathogenesis?

When investigating YqhA function in Salmonella pathogenesis, researchers should consider these experimental design approaches:

  • Gene knockout studies: Generate YqhA-deficient Salmonella strains using CRISPR-Cas9 or homologous recombination techniques

  • Complementation assays: Reintroduce wild-type or mutant YqhA to knockout strains to validate phenotypes

  • Reporter fusion constructs: Create YqhA-reporter fusions to monitor expression and localization during infection

  • Infection models:

    • In vitro: Macrophage infection assays (RAW264.7 or THP-1 cells)

    • In vivo: Mouse models with different routes of administration

  • Stepped wedge designs: For studying YqhA-targeting interventions in complex models

Implementation science principles suggest incorporating randomized controlled trial designs when feasible, using appropriate controls including non-equivalent control groups for quasi-experimental approaches . For in vivo studies, interrupted time series analysis can be particularly powerful for capturing dynamic responses to YqhA manipulation.

How can quantitative proteomics approaches be optimized for studying YqhA expression and interactions?

Advanced proteomics approaches for YqhA research include:

  • HILAQ methodology: Heavy Isotope Labeled Azidohomoalanine Quantification allows for:

    • Selective labeling of newly synthesized YqhA

    • Enrichment through click chemistry

    • Precise quantification via mass spectrometry

  • Implementation protocol:

    • Pulse-label cells with heavy-AHA

    • Add biotin via click reaction

    • Precipitate and digest proteins

    • Enrich AHA-biotin peptides

    • Perform MS analysis and quantification

This approach offers 5× greater sensitivity than protein-level enrichment methods, allowing detection of low-abundance YqhA interactions that may be missed by conventional approaches . For YqhA-specific adaptations, researchers should:

  • Optimize AHA incorporation timing (typically 1-4 hours)

  • Consider peptide-level enrichment rather than protein-level enrichment

  • Avoid TMT labeling as it may interfere with AHA-biotin peptide enrichment

What is the role of YqhA in Salmonella infection and host immune response modulation?

While the specific function of YqhA remains under investigation, research on Salmonella infections provides context for experimental approaches:

  • Infection dynamics: Salmonella infection triggers proinflammatory cytokine production, particularly TNF-alpha and IL-1 beta

  • Intervention approaches:

    • Live probiotic administration inhibits Salmonella growth through pH modulation

    • Heat-killed probiotics demonstrate coaggregation properties that facilitate Salmonella discharge

For YqhA-specific studies, researchers should measure:

  • Changes in proinflammatory cytokine levels (TNF-alpha, IL-1 beta)

  • Bacterial colonization and shedding patterns

  • YqhA expression levels during different infection stages

Experimental evidence suggests monitoring both pathogen behavior and host immune responses simultaneously provides the most complete picture of protein function during infection dynamics.

What are the challenges in membrane protein characterization specific to YqhA structural studies?

YqhA presents typical membrane protein characterization challenges that require specialized approaches:

  • Solubilization optimization:

    • Test multiple detergents (DDM, LMNG, DMNG)

    • Evaluate nanodiscs or amphipols as alternatives

    • Determine critical micelle concentration effects on structure

  • Structural determination methods:

    • X-ray crystallography: Requires extensive screening for crystal formation

    • Cryo-EM: Increasingly viable for membrane proteins >50 kDa

    • NMR: Most appropriate for dynamic studies of specific domains

  • Functional validation:

    • Reconstitution into proteoliposomes for activity assays

    • Mutation of predicted functional residues

    • Interaction studies with potential binding partners

Researchers should incorporate multiple complementary techniques rather than relying on a single structural approach to overcome the inherent challenges of membrane protein characterization.

How does YqhA expression respond to environmental stressors relevant to host infection?

Research on related Salmonella genes provides a framework for YqhA stress response studies:

  • Hypoxic conditions: Several Salmonella genes show altered expression under anaerobic conditions mimicking the host environment

  • Iron availability: Consider examining YqhA in relation to iron acquisition systems like:

    • entCEBA operon

    • exbBD operon

    • feoABC operon

    • yqjH and fhuF genes

  • Metabolic adaptation: Examine YqhA expression in relation to:

    • Glycolysis (gapA, yeaD, tpi, fbp)

    • Fatty acid metabolism

    • Energy production (cydAB operon)

Experimental approaches should include RNA-seq or tiling array analysis under controlled stress conditions, with validation by Northern blot analysis and stability assays for highly regulated transcripts.

What are the best practices for designing YqhA mutation studies to elucidate structure-function relationships?

Strategic mutation design for YqhA structure-function studies should follow these principles:

  • Target selection approach:

    • Highly conserved residues across Salmonella species

    • Predicted functional domains based on bioinformatic analysis

    • Transmembrane regions and potential binding sites

  • Mutation strategies:

    • Alanine scanning of conserved regions

    • Conservative vs. non-conservative substitutions

    • Domain swapping with related proteins

    • Truncation series to identify minimal functional units

  • Validation methodology:

    • Complementation of yqhA knockout strains

    • In vitro binding assays with potential partners

    • Localization studies of mutant proteins

    • Stability assessment via thermal shift assays

Create a systematic mutation panel rather than testing isolated mutations to build a comprehensive structure-function map.

How can researchers effectively analyze YqhA in the context of bacterial transcriptomics?

Transcriptomic analysis of YqhA should incorporate these methodological considerations:

  • RNA-seq optimization:

    • Compare aerobic vs. anaerobic conditions

    • Examine various infection-relevant stress conditions

    • Include time-course sampling to capture dynamic responses

  • Data analysis pipeline:

    • Quantile-based K-means clustering to identify co-regulated genes

    • Special attention to REP (repetitive extragenic palindromic) sequences

    • Northern blot validation of highly regulated transcripts

  • Integration with other data types:

    • Proteomics correlation analysis

    • Metabolomic changes associated with YqhA expression

    • ChIP-seq for potential regulatory interactions

Researchers should particularly note that approximately 40% of highly regulated Salmonella genes contain REP sequences, which may be relevant for YqhA regulation .

What controls and standards should be included in YqhA functional assays?

Rigorous experimental design requires these controls and standards:

Control TypePurposeImplementation
Positive controlsVerify assay functionalityInclude well-characterized membrane proteins
Negative controlsEstablish baseline/backgroundEmpty vector, unrelated membrane proteins
Technical replicatesAssess method reproducibilityMinimum n=3 for each experimental condition
Biological replicatesAccount for biological variationIndependent protein preparations, n≥3
Standard curvesEnable quantificationPurified protein standards of known concentration
Validation controlsConfirm specificityAntibody validation, knockout verification

For YqhA specifically, include the related proteins from S. paratyphi A as reference standards for comparative studies, as they share 99.4% sequence identity but may exhibit functional differences .

How can computational approaches enhance YqhA research?

Computational methods offer valuable insights into YqhA structure and function:

  • Structural prediction:

    • AlphaFold2 for tertiary structure prediction

    • TMHMM or TOPCONS for transmembrane topology

    • ConSurf for conservation mapping and functional site prediction

  • Molecular dynamics:

    • Simulate YqhA behavior in membrane environments

    • Evaluate stability of predicted binding interactions

    • Test effects of mutations on protein dynamics

  • Network analysis:

    • Predict functional partners through co-expression networks

    • Identify potential regulatory relationships

    • Map YqhA to known Salmonella pathogenesis pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.