Recombinant Salmonella paratyphi B UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yfbV; SPAB_00639; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPVAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0208 membrane protein YfbV and why is it significant in Salmonella research?

YfbV (UPF0208) is a membrane protein found in various Salmonella enterica serovars, including S. paratyphi B. The "UPF" designation indicates it's an uncharacterized protein family with conserved sequence across bacterial species. Its significance stems from its presence across pathogenic Salmonella strains, suggesting potential roles in bacterial physiology or virulence .

YfbV is particularly interesting because it represents one of many membrane proteins in Salmonella that remain functionally uncharacterized despite conservation across species, making it a candidate for understanding basic bacterial membrane biology and potentially identifying novel therapeutic targets .

How is recombinant Salmonella paratyphi B YfbV protein typically expressed and purified?

Recombinant YfbV from S. paratyphi B is typically expressed using E. coli expression systems with an N-terminal His-tag for purification purposes. The methodology involves:

  • Cloning the yfbV gene into an expression vector with a His-tag sequence

  • Transforming the construct into a suitable E. coli strain (often BL21(DE3))

  • Inducing protein expression with IPTG

  • Lysing the cells and purifying using Ni-NTA affinity chromatography

  • Further purification using size exclusion chromatography if needed

While E. coli expression systems offer high yields and faster turnaround times, expression in yeast, insect cells, or mammalian cells can provide alternative advantages when post-translational modifications are necessary for functional studies .

What are the optimal storage and handling conditions for recombinant YfbV protein?

For optimal stability and activity, recombinant YfbV protein should be stored following these guidelines:

Storage ConditionRecommendation
Long-term storage-20°C to -80°C in aliquots to avoid freeze-thaw cycles
Buffer compositionTris-based buffer with 50% glycerol, pH 8.0
Working aliquotsStore at 4°C for up to one week
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Lyophilized formCan be stored at -20°C with desiccant

Repeated freeze-thaw cycles should be avoided as they can significantly decrease protein stability and activity .

What is known about the structural features of YfbV protein and how do they relate to its potential function?

The YfbV protein from Salmonella exhibits structural features characteristic of an integral membrane protein. Computational structure models from related proteins (such as E. coli YfbV) show:

  • Multiple transmembrane alpha-helical domains spanning the bacterial membrane

  • A global pLDDT (predicted Local Distance Difference Test) score of approximately 81.8, indicating a confident structural model

  • Regions of varying confidence levels, with transmembrane domains typically showing higher confidence scores than loop regions

  • Potential structural similarity to transporters or channel proteins based on fold recognition

How does YfbV protein expression correlate with Salmonella paratyphi B virulence and pathogenicity?

While direct evidence linking YfbV to S. paratyphi B virulence remains limited, several correlative observations suggest potential involvement:

  • YfbV is conserved across pathogenic Salmonella strains, indicating potential importance in bacterial survival or virulence

  • As a membrane protein, YfbV may participate in host-pathogen interactions or environmental sensing

  • The distinction between S. paratyphi B tartrate-negative (causing paratyphoid fever) and tartrate-positive strains (causing gastroenteritis) may involve differential expression or function of membrane proteins like YfbV

Further research using gene knockout or mutation studies would be necessary to definitively establish YfbV's role in virulence. Current understanding of S. paratyphi pathogenesis indicates that membrane proteins often contribute to adhesion, invasion, and survival within host cells .

What are the challenges in crystallizing membrane proteins like YfbV for structural studies?

Crystallization of membrane proteins like YfbV presents several significant challenges:

  • Hydrophobicity and stability issues:

    • Membrane proteins require detergents or lipid environments to maintain stability

    • Finding optimal detergent conditions that maintain native structure while allowing crystal contacts is difficult

  • Expression and purification complexities:

    • Achieving sufficient quantities of properly folded protein

    • Maintaining homogeneity throughout the purification process

    • Removing detergent micelles that interfere with crystallization

  • Crystal packing constraints:

    • Limited polar surfaces for crystal contact formation

    • Detergent micelles can obstruct potential crystal contacts

  • Alternative approaches:

    • Lipidic cubic phase crystallization methods

    • Cryo-electron microscopy for structure determination without crystallization

    • Computational approaches like AlphaFold to predict structures (as seen with E. coli YfbV)

How can post-translational modifications of YfbV affect its function and experimental analysis?

Post-translational modifications (PTMs) of YfbV may significantly impact its function and experimental analysis:

  • Potential PTMs in bacterial membrane proteins:

    • Phosphorylation (affecting regulatory functions)

    • Glycosylation (rare in bacterial proteins but possible)

    • Lipid modifications (affecting membrane localization)

  • Effects on experimental analysis:

    • Expression system choice affects PTM profiles (E. coli vs. insect or mammalian cells)

    • Mass spectrometry analysis may reveal unexpected modifications

    • Functional assays may yield different results depending on PTM status

  • Methodological considerations:

    • When studying potential regulatory mechanisms, expression in systems capable of appropriate PTMs may be necessary

    • Comparing different expression systems can help identify PTM-dependent functions

    • Site-directed mutagenesis of potential modification sites can determine their functional significance

What expression systems are most suitable for producing functional recombinant YfbV protein?

Different expression systems offer distinct advantages for YfbV production, depending on research objectives:

Expression SystemAdvantagesDisadvantagesBest Applications
E. coliHigh yields, rapid production, cost-effective, suitable for isotope labelingLimited PTMs, inclusion body formation possibleStructural studies, antibody production, interaction studies
YeastModerate yields, some eukaryotic PTMs, proper foldingLonger production time, different glycosylation patternsFunctional studies requiring limited PTMs
Insect cellsGood membrane protein expression, more native-like PTMsHigher cost, technical complexity, longer timelineStudies requiring proper folding and PTMs
Mammalian cellsMost native-like PTMs, proper foldingLowest yields, highest cost and complexityFunctional studies requiring authentic PTMs

What experimental approaches can determine YfbV membrane topology and orientation?

Several complementary experimental approaches can determine YfbV membrane topology:

  • Protease accessibility mapping:

    • Treat intact bacterial cells or spheroplasts with proteases

    • Identify protected fragments using mass spectrometry or Western blotting

    • Regions accessible to proteases are likely exposed outside the membrane

  • Cysteine scanning mutagenesis:

    • Introduce cysteine residues at various positions

    • Test accessibility using membrane-impermeable sulfhydryl reagents

    • Accessible cysteines indicate exposure to aqueous environments

  • Fluorescence techniques:

    • Generate GFP fusion proteins at different termini or loop regions

    • Analyze fluorescence distribution in bacterial cells

    • Determine cellular localization and membrane insertion

  • Computational prediction validation:

    • Compare experimental results with transmembrane prediction algorithms

    • Refine structural models based on experimental constraints

    • Integrate with homology modeling based on related proteins with known structures

How can researchers effectively design antibodies against YfbV for localization and functional studies?

Effective antibody design for YfbV studies requires strategic approaches:

  • Epitope selection considerations:

    • Target extracellular or periplasmic loops (7-15 amino acids) for accessibility

    • Avoid highly hydrophobic transmembrane regions

    • Select sequences unique to YfbV to prevent cross-reactivity

    • Consider multiple epitopes from different regions

  • Production strategies:

    • Use synthetic peptides corresponding to selected epitopes for immunization

    • Alternatively, use recombinant protein fragments representing extracellular domains

    • Consider both polyclonal (broader recognition) and monoclonal (higher specificity) approaches

  • Validation methods:

    • Test against recombinant YfbV protein

    • Confirm specificity using yfbV knockout strains as negative controls

    • Perform peptide competition assays to verify epitope-specific binding

    • Validate in multiple applications (Western blot, immunofluorescence, immunoprecipitation)

  • Application-specific optimizations:

    • For immunofluorescence, optimize fixation to preserve epitope accessibility

    • For immunoprecipitation, consider detergent conditions that maintain protein structure

What functional assays can be employed to investigate the biological role of YfbV?

To investigate YfbV's biological function, several complementary approaches can be employed:

  • Genetic manipulation approaches:

    • Gene knockout or knockdown studies to assess phenotypic changes

    • Complementation studies to confirm phenotype specificity

    • Site-directed mutagenesis to identify critical residues

  • Protein interaction studies:

    • Pull-down assays using tagged YfbV to identify binding partners

    • Bacterial two-hybrid systems for membrane protein interactions

    • Cross-linking studies to capture transient interactions

    • Co-immunoprecipitation with potential partners

  • Localization and trafficking:

    • Fluorescent protein fusions to track dynamic localization

    • Immunoelectron microscopy for precise subcellular localization

    • Fractionation studies to confirm membrane association

  • Physiological assays:

    • Membrane permeability assessments in wild-type vs. mutant strains

    • Stress response measurements (pH, temperature, osmotic stress)

    • Virulence-related phenotypes (adhesion, invasion, intracellular survival)

    • Transport assays if YfbV functions as a transporter or channel

How does Salmonella paratyphi B YfbV compare structurally to homologous proteins in other bacterial species?

Structural comparison of YfbV across bacterial species reveals important evolutionary insights:

  • Sequence conservation patterns:

    • High conservation within Salmonella species (>90% identity)

    • Moderate conservation with E. coli homologs (approximately 80% identity)

    • Transmembrane domains show higher conservation than loop regions

  • Structural features comparison:

    • AlphaFold predictions for E. coli YfbV show a multi-pass membrane protein structure

    • Similar fold predictions extend to Salmonella YfbV homologs

    • The pLDDT confidence score of 81.8 for E. coli YfbV indicates a reliable structural prediction

  • Functional implications:

    • Conservation across species suggests fundamental cellular functions

    • Species-specific variations may relate to pathogen-specific adaptations

    • Structural similarity to proteins of known function may provide functional clues

  • Evolution perspective:

    • Conservation patterns suggest YfbV predates the divergence of Salmonella and E. coli

    • Membrane proteins typically evolve more slowly than soluble proteins

What bioinformatic tools are most effective for predicting functional domains in YfbV?

For effective functional domain prediction in YfbV, researchers should employ multiple complementary bioinformatic approaches:

  • Sequence-based predictions:

    • PFAM for protein family identification and domain architecture

    • PROSITE for motif identification and functional site prediction

    • TMHMM and TOPCONS for transmembrane domain prediction

    • SignalP for signal peptide prediction

  • Structure-based analyses:

    • AlphaFold or RoseTTAFold for tertiary structure prediction

    • ProFunc for structure-based function prediction

    • CASTp for binding pocket identification

    • ConSurf for evolutionary conservation mapping onto structural models

  • Comparative genomics approaches:

    • Phylogenetic profiling to identify co-evolving genes

    • Genomic context analysis (gene neighborhood analysis)

    • Analysis of co-expression patterns with genes of known function

  • Integration strategies:

    • Combine multiple predictions through consensus approaches

    • Validate predictions through targeted experimental approaches

    • Iteratively refine predictions based on experimental feedback

How can researchers identify potential interaction partners of YfbV in Salmonella paratyphi B?

Identifying YfbV interaction partners requires systematic approaches:

  • Affinity-based methods:

    • Tandem affinity purification (TAP) with His-tagged YfbV

    • Co-immunoprecipitation using YfbV-specific antibodies

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

    • Proximity-dependent biotin identification (BioID) or APEX2 labeling

  • Genetic approaches:

    • Suppressor mutation analysis

    • Synthetic genetic array analysis

    • Bacterial two-hybrid screening

    • Genetic epistasis testing

  • Bioinformatic predictions:

    • Protein-protein interaction database mining

    • Co-expression analysis across conditions

    • Structural docking with potential partners

    • Evolutionary coupling analysis

  • Validation strategies:

    • Reverse pull-down experiments

    • Mutagenesis of interaction interfaces

    • Functional assays examining co-dependent phenotypes

    • Localization studies showing co-localization

How do tartrate-negative and tartrate-positive strains of S. paratyphi B differ in YfbV expression and function?

The distinction between tartrate-negative and tartrate-positive S. paratyphi B strains correlates with different disease manifestations and may involve YfbV:

  • Expression differences:

    • Limited studies suggest potential regulatory differences in membrane protein expression

    • Tartrate-negative strains (causing paratyphoid fever) may show differential YfbV expression compared to tartrate-positive strains (causing gastroenteritis)

  • Functional implications:

    • Tartrate-negative strains show higher invasiveness and systemic spread

    • Membrane proteins like YfbV may contribute to different tissue tropism or host interactions

    • Differences in post-translational modifications or protein-protein interactions may exist

  • Research approaches:

    • Comparative transcriptomics and proteomics between strain types

    • Reciprocal gene complementation studies

    • Heterologous expression to test functional differences

    • Structural comparison of YfbV variants between strains

  • Clinical relevance:

    • Understanding these differences may help explain the distinct clinical presentations

    • Could identify targets for strain-specific diagnostics or therapeutics

What are the applications of recombinant YfbV protein in Salmonella detection and vaccine development?

Recombinant YfbV protein has several potential research and applied applications:

  • Diagnostic applications:

    • Development of YfbV-specific antibodies for immunodiagnostics

    • ELISA-based detection systems for Salmonella identification

    • Potential biomarker for specific Salmonella serovars

  • Vaccine development considerations:

    • Assessment as a potential vaccine component:

      • Conservation across strains supports broad protection

      • Membrane localization enables antibody accessibility

    • Epitope mapping for subunit vaccine design

    • Safety and immunogenicity studies in animal models

  • Research applications:

    • Tool for studying Salmonella membrane biology

    • Reference standard for antibody production and validation

    • Platform for structure-function relationship studies

  • Challenges and limitations:

    • Need for proper folding and presentation of conformational epitopes

    • Potential cross-reactivity with homologs in other bacteria

    • Requirement for appropriate adjuvants to enhance immunogenicity

How can recombinant YfbV contribute to understanding antibiotic resistance mechanisms in Salmonella?

Recombinant YfbV protein research may provide insights into antibiotic resistance:

  • Potential contributions to membrane permeability:

    • If YfbV influences membrane structure or permeability, it may affect antibiotic entry

    • Altered expression in resistant strains could suggest involvement in resistance mechanisms

    • Interaction with known resistance-associated membrane proteins would be significant

  • Research approaches:

    • Compare YfbV expression in susceptible vs. resistant isolates

    • Examine effects of YfbV overexpression or deletion on antibiotic susceptibility

    • Investigate structural changes in YfbV from resistant strains

    • Test for direct interactions with antibiotics using binding assays

  • Translational potential:

    • YfbV manipulation as a potential strategy to enhance antibiotic efficacy

    • Development of adjuvants that target YfbV function

    • Structure-based design of novel antimicrobials targeting YfbV

  • Integration with other resistance studies:

    • Correlation with efflux pump expression

    • Analysis in the context of global membrane compositional changes

    • Examination of regulatory networks affecting multiple resistance mechanisms

What are the key research gaps in our understanding of YfbV protein function?

Despite advances in structural prediction and expression systems, significant knowledge gaps remain:

  • Functional characterization:

    • The precise biological function of YfbV remains uncharacterized

    • Potential roles in transport, signaling, or structural integrity need experimental validation

    • Substrate specificity (if any) is unknown

  • Regulatory mechanisms:

    • Factors controlling yfbV gene expression are poorly understood

    • Post-translational regulation mechanisms remain unexplored

    • Environmental signals affecting YfbV function are not identified

  • Pathogenesis relevance:

    • Direct evidence linking YfbV to Salmonella virulence is lacking

    • Strain-specific variations in function require further investigation

    • Host-pathogen interaction potential needs exploration

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.