Recombinant Salmonella paratyphi B UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
ycjF; SPAB_01574; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIVGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPALQRWYAAIHE TQNDREIVGLYAHLVQPVLDAQARREISRFAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELMREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant production of ycjF protein?

E. coli is the predominant expression system used for recombinant production of ycjF proteins from Salmonella strains. The available literature indicates that for Salmonella paratyphi B UPF0283 membrane protein ycjF, heterologous expression in E. coli has been successfully implemented with N-terminal His-tagging for purification purposes . This approach leverages the genetic similarity between E. coli and Salmonella while providing high yield protein production.

For membrane proteins like ycjF, the E. coli expression system offers several advantages:

  • High expression levels under optimized conditions

  • Compatibility with the prokaryotic membrane insertion machinery

  • Well-established protocols for induction and harvest

  • Relatively simple scale-up capabilities

What are the optimal storage conditions for maintaining ycjF protein stability?

Based on experimental data from related ycjF proteins, the following storage recommendations apply:

  • Long-term storage: Store at -20°C/-80°C in aliquots to prevent repeated freeze-thaw cycles

  • Buffer composition: Tris/PBS-based buffer supplemented with 6% Trehalose at pH 8.0

  • Working solution preparation: For short-term use, store working aliquots at 4°C for up to one week

  • Reconstitution protocol: Briefly centrifuge the vial prior to opening, then reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Cryoprotection: Addition of glycerol (5-50% final concentration) is recommended before aliquoting for long-term storage, with 50% being the standard concentration

These conditions have been empirically determined to maintain protein integrity and functionality while minimizing degradation. The addition of trehalose in the storage buffer serves as a stabilizing agent that helps preserve protein structure during freeze-thaw cycles by preventing protein aggregation and denaturation .

How do ycjF proteins from different Salmonella strains compare?

Comparative analysis of ycjF proteins from different Salmonella strains reveals high sequence conservation with minor variations that may reflect strain-specific adaptations:

StrainUniProt IDSequence LengthKey Sequence VariationsSimilarity to S. paratyphi B
S. paratyphi BA9MWW8353 aaReference sequence100%
S. paratyphi AB5BJ45353 aaQ→P at position 204, E→A at position 231>98%
S. typhimuriumQ8ZP64353 aaA→V at position 82>99%

The high degree of conservation across different Salmonella strains suggests that ycjF likely plays an important and conserved function in these organisms . The minor amino acid substitutions appear primarily in the middle region of the protein, while the N and C-terminal regions show greater conservation. This pattern may indicate functional constraints on the terminal regions, possibly related to membrane integration or interaction with other cellular components.

What purification methods yield the highest purity for recombinant ycjF?

For His-tagged recombinant ycjF proteins, immobilized metal affinity chromatography (IMAC) is the primary purification method, typically yielding >90% purity as determined by SDS-PAGE . A comprehensive purification workflow involves:

  • Initial clarification: Centrifugation of cell lysate to remove insoluble debris

  • Capture step: IMAC purification using Ni-NTA or similar resin

  • Intermediate purification: Size exclusion chromatography to remove aggregates

  • Polishing: Ion exchange chromatography if higher purity is required

  • Quality control: SDS-PAGE analysis to confirm purity (>90%)

For membrane proteins like ycjF, inclusion of appropriate detergents during extraction and purification is critical. Gentle detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) are often employed to solubilize the protein while maintaining native-like conformation . The choice of detergent may need to be optimized depending on downstream applications.

How can the Type III Secretion System (T3SS) be leveraged for functional studies of ycjF?

The Type III Secretion System (T3SS) represents a sophisticated biological machinery that can be exploited for functional studies of proteins like ycjF. For investigating ycjF function, researchers can employ the following T3SS-based approaches:

  • Chimeric protein delivery: By fusing ycjF to the first 167 amino acids of the SptP effector protein (SptP167), which contains both the secretion signal and chaperone binding domain, researchers can create constructs that are efficiently secreted through the T3SS .

  • Controlled expression systems: The pCASP plasmid system can be used to place ycjF expression under the control of the pSicA promoter, ensuring co-regulation with Salmonella pathogenicity island-1 (SPI-1) gene expression .

  • In vivo localization studies: By tagging ycjF with reporter proteins (e.g., 3×FLAG tag) at the C-terminus while maintaining the N-terminal secretion signal, researchers can track the subcellular localization following T3SS-mediated delivery .

  • Host-pathogen interaction studies: T3SS-mediated delivery of ycjF into host cells can reveal potential interactions with host proteins or effects on host cellular processes, providing insights into its function during infection .

This approach allows for studying ycjF in a more physiologically relevant context compared to conventional overexpression systems, potentially revealing roles in virulence or host-pathogen interactions that might not be apparent in other experimental setups.

What experimental approaches can resolve contradictory findings about ycjF membrane topology?

Resolving membrane protein topology remains challenging, and contradictory findings about ycjF membrane orientation can be addressed through multiple complementary approaches:

  • Cysteine scanning mutagenesis: Systematically replace residues throughout the protein with cysteine and assess accessibility to membrane-impermeable thiol-reactive reagents. This approach can map which regions are exposed to either side of the membrane.

  • Protease protection assays: In spheroplasts or inverted membrane vesicles, determine which regions of ycjF are susceptible to protease digestion, indicating their accessibility.

  • Reporter fusion analysis: Create fusion proteins with reporters like alkaline phosphatase (PhoA) or green fluorescent protein (GFP) at different positions and assess activity/fluorescence to determine cellular localization.

  • Epitope insertion and antibody accessibility: Insert small epitope tags at various positions and determine accessibility via antibody binding in permeabilized versus non-permeabilized cells.

  • Molecular dynamics simulations: Perform computational analysis of ycjF sequence using current membrane protein topology prediction algorithms, followed by validation with experimental data.

By integrating data from these complementary approaches, researchers can build a consensus model of ycjF topology and resolve conflicting results that may arise from technical limitations of individual methods.

What role might ycjF play in membrane traffic and cellular homeostasis?

While the specific function of ycjF remains to be fully elucidated, several lines of evidence suggest potential roles in membrane traffic and cellular homeostasis:

  • Structural analysis: The transmembrane domains and conserved cytoplasmic regions of ycjF suggest it may function as a scaffold for protein complexes involved in membrane remodeling or vesicle transport .

  • Conservation patterns: The high conservation of ycjF across Salmonella species indicates an important biological function, potentially related to fundamental aspects of bacterial physiology rather than strain-specific adaptations .

  • Contextual function: Recent research on membrane traffic has highlighted the importance of both structured protein motifs and intrinsically disordered proteins (IDPs) in driving membrane remodeling and fission events . ycjF may participate in these processes through interactions with other membrane-associated proteins.

  • Potential involvement in stress response: The regulation patterns of ycjF expression under different environmental conditions suggest it may contribute to cellular adaptations to stress, possibly through modulating membrane properties or protein homeostasis pathways.

Research on membrane trafficking mechanisms has demonstrated that proteins without defined structures can significantly impact membrane bending and remodeling through entropic pressure . Further investigation of ycjF in this context could reveal unexpected roles in membrane dynamics that contribute to bacterial survival and pathogenesis.

How do post-translational modifications affect ycjF function and stability?

Post-translational modifications (PTMs) may significantly impact ycjF function and stability, though this remains an underexplored area. Researchers investigating PTMs of ycjF should consider:

  • Phosphorylation sites: Bioinformatic analysis suggests potential phosphorylation sites in the cytoplasmic domains of ycjF that could modulate protein-protein interactions or conformational changes.

  • Proteolytic regulation: Evidence from related bacterial systems, such as the FtsH-dependent degradation observed in Yersinia enterocolitica proteins, suggests ycjF may be subject to regulated proteolysis . This could represent an important control mechanism for ycjF levels and activity.

  • Experimental approaches for PTM identification:

    • Mass spectrometry-based proteomics to identify modifications

    • Site-directed mutagenesis of predicted modification sites

    • In vitro enzymatic assays to confirm modification mechanisms

    • Stability assays comparing wild-type and modification-site mutants

  • Functional implications: PTMs may affect ycjF's:

    • Membrane localization and topology

    • Interaction with other membrane proteins

    • Stability and turnover rate

    • Response to environmental signals

The comparison with other bacterial membrane proteins suggests that regulation through PTMs could be a key mechanism controlling ycjF activity in response to changing environmental conditions or during different stages of infection.

What are the optimal conditions for structural studies of ycjF using advanced biophysical techniques?

Structural characterization of membrane proteins like ycjF presents significant challenges. Based on current methodologies, researchers should consider these optimized approaches:

These methodological approaches must be tailored to the specific properties of ycjF, with particular attention to maintaining protein stability throughout the purification and analysis workflow. Integrating data from multiple techniques will likely provide the most comprehensive structural understanding of this challenging membrane protein.

How should researchers design experiments to investigate ycjF-host cell interactions?

When investigating potential interactions between ycjF and host cells, researchers should implement a multi-faceted experimental design:

  • Delivery systems optimization:

    • T3SS-mediated delivery using the SptP167 fusion strategy

    • Comparison with alternative delivery methods (e.g., lipid-based transfection, electroporation)

    • Quantification of delivery efficiency using western blotting or flow cytometry

  • Host response assessment:

    • Transcriptomic analysis (RNA-seq) of host cells exposed to ycjF

    • Phosphoproteomic analysis to identify signaling pathways affected

    • Cytokine/chemokine profiling to characterize inflammatory responses

    • Live-cell imaging to monitor dynamic cellular changes

  • Interaction partners identification:

    • Proximity labeling approaches (BioID, APEX) to identify proteins in spatial proximity to ycjF in host cells

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening with cytoplasmic domains as bait

    • Fluorescence resonance energy transfer (FRET) for direct interaction validation

  • Functional validation:

    • CRISPR-Cas9 knockout of identified host targets

    • Complementation assays with ycjF variants

    • Competitive inhibition studies with peptides derived from ycjF sequence

    • Site-directed mutagenesis of key residues identified in interaction studies

This comprehensive approach allows researchers to systematically characterize how ycjF may influence host cell biology during Salmonella infection, potentially identifying novel targets for therapeutic intervention.

What controls are essential when studying ycjF membrane localization and dynamics?

Rigorous experimental design for ycjF localization studies requires careful consideration of controls:

  • Expression-level controls:

    • Titration of expression levels to avoid artifacts from overexpression

    • Inducible promoter systems to achieve physiologically relevant expression

    • Comparison with native expression levels using quantitative western blotting

  • Localization controls:

    • Parallel analysis of known membrane proteins with established topology

    • Fractionation quality controls using markers for different cellular compartments

    • Membrane extraction controls with different detergents and buffers

  • Tag interference controls:

    • Comparison of N- versus C-terminal tags to assess potential disruption

    • Inclusion of linker sequences of varying lengths

    • Functional complementation assays to verify tagged protein activity

  • Technical validation controls:

    • Multiple microscopy techniques (confocal, TIRF, super-resolution)

    • Orthogonal biochemical fractionation approaches

    • Live-cell versus fixed-cell imaging comparison

  • Physiological relevance controls:

    • Analysis under different growth conditions and stress stimuli

    • Comparison across growth phases

    • Assessment in different genetic backgrounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.