Recombinant Salmonella paratyphi B UPF0756 membrane protein YeaL (yeaL)

What is the YeaL protein in Salmonella paratyphi B and what are its key structural features?

The YeaL protein in Salmonella paratyphi B is classified as a UPF0756 membrane protein with 148 amino acids. Its amino acid sequence (MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPLNTFFPWIEKQGLTVGIIILTIGVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQPQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ) suggests it is a hydrophobic protein with multiple transmembrane domains . The protein has been assigned UniProt ID A9N2A7 and belongs to the uncharacterized protein family UPF0756, suggesting its function has not been fully elucidated in scientific literature . Structural predictions indicate it likely functions as an integral membrane protein with probable roles in membrane transport or signaling.

How does the YeaL protein from Salmonella paratyphi B compare with homologous proteins in other Salmonella strains?

The YeaL protein is highly conserved among Salmonella species. Comparing the amino acid sequences of YeaL from Salmonella paratyphi B (UniProt ID: A9N2A7) and Salmonella paratyphi A (UniProt ID: Q5PHE0), we observe 100% sequence identity across the 148-amino acid length . This perfect conservation suggests critical functional importance across Salmonella species. Both proteins are annotated as UPF0756 membrane proteins with identical amino acid sequences, indicating evolutionary conservation of this membrane protein among different Salmonella serovars, despite other genomic differences that distinguish these pathogens.

What expression systems are optimal for recombinant production of YeaL protein?

For recombinant production of YeaL protein, E. coli has been demonstrated as an effective expression system . Standard protocols involve fusing the full-length protein (amino acids 1-148) with an N-terminal His-tag to facilitate purification. When expressing this hydrophobic membrane protein, optimization of induction parameters is essential - including temperature (typically 16-25°C for membrane proteins), IPTG concentration, and induction duration to balance yield with proper folding. Bacterial strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3), may provide better results than standard BL21 derivatives when expression toxicity is observed . Success has been demonstrated with both Salmonella paratyphi A and B YeaL variants using this system, resulting in proteins with >90% purity as determined by SDS-PAGE.

What are the recommended protocols for purification and storage of recombinant YeaL protein?

For effective purification of His-tagged YeaL protein, a multi-step chromatography approach is recommended. Initial purification should utilize immobilized metal affinity chromatography (IMAC) with Ni-NTA resin, followed by size-exclusion chromatography to enhance purity. When working with this membrane protein, inclusion of detergents (such as DDM, LDAO, or OG) in all buffers is essential to maintain solubility. For storage, lyophilization has proven effective for long-term stability . The protein should be stored at -20°C or -80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles that could compromise protein integrity. Working aliquots may be stored at 4°C for up to one week. Reconstitution protocols involve centrifuging the vial before opening, rehydrating with deionized sterile water to 0.1-1.0 mg/mL, and adding glycerol (5-50% final concentration) for optimal long-term storage .

What analytical methods are most appropriate for assessing the quality and purity of recombinant YeaL protein preparations?

Rigorous quality assessment of recombinant YeaL preparations should employ multiple complementary techniques. SDS-PAGE remains the primary method for purity assessment, with expectations of >90% homogeneity for research applications . For membrane proteins like YeaL, modified SDS-PAGE protocols using gradient gels (10-20%) can improve resolution. Immunoblotting with anti-His antibodies confirms identity and integrity of the tagged protein. Mass spectrometry (particularly MALDI-TOF or ESI-MS) provides precise molecular weight determination and can verify post-translational modifications. Circular dichroism spectroscopy is valuable for confirming proper secondary structure, especially important for membrane proteins where proper folding affects functionality. Finally, dynamic light scattering should be employed to assess homogeneity and detect potential aggregation, which is particularly common with membrane proteins like YeaL during purification processes.

How can researchers troubleshoot common issues in recombinant YeaL expression and purification?

When troubleshooting recombinant YeaL expression, researchers should systematically address several common challenges. For low expression yields, optimization strategies include: (1) testing multiple E. coli strains specialized for membrane proteins, (2) varying induction parameters (temperature reduction to 16-18°C, IPTG concentration adjustments), and (3) supplementing with rare codons through codon-optimized constructs or specialized strains . For protein insolubility, increasing detergent concentrations or testing alternative detergents (LDAO, DDM, OG) may improve results. When protein degradation is observed, adding protease inhibitors throughout purification and reducing processing time and temperature can preserve integrity. If protein aggregation occurs during storage, researchers should consider: (1) increasing glycerol concentration up to 50%, (2) exploring alternative buffer compositions, particularly adjusting pH toward 8.0, and (3) implementing a more stringent aliquoting strategy to minimize freeze-thaw cycles .

What functional assays are available for characterizing the biological activity of YeaL protein?

While YeaL is currently classified as an uncharacterized protein (UPF0756 family), several approaches can be employed to investigate its function. Membrane localization studies using fluorescently-tagged YeaL constructs can confirm proper cellular distribution. Protein-protein interaction studies utilizing pull-down assays, co-immunoprecipitation, or bacterial two-hybrid systems may identify binding partners to elucidate functional networks. Phenotypic characterization of knockout mutants (ΔyeaL) can reveal effects on bacterial growth, stress response, or pathogenicity. For membrane proteins, reconstitution into proteoliposomes followed by transport assays (measuring ion or small molecule flux) can determine if YeaL functions as a transporter or channel. Since yeaL gene expression patterns may provide functional clues, qRT-PCR analysis under various stress conditions (pH, temperature, antimicrobial exposure) can correlate expression with specific physiological states, potentially revealing functional roles in bacterial adaptability or pathogenesis.

How does YeaL protein contribute to Salmonella paratyphi B pathogenicity or survival mechanisms?

The contribution of YeaL to Salmonella paratyphi B pathogenicity remains incompletely characterized, but membrane proteins often play crucial roles in bacterial pathogenesis. Research approaches for elucidating YeaL's role should include comparative virulence studies between wild-type and yeaL-knockout strains in infection models. Evidence from related pathogens suggests membrane proteins like YeaL may contribute to host colonization, antibiotic resistance, or environmental stress adaptation . In particular, patients with S. Paratyphi B infections have shown persistent carriage states requiring extended antibiotic treatment, suggesting potential roles for membrane components in establishing persistent infections . Cell invasion assays using epithelial cell lines can determine if YeaL affects bacterial internalization. Survival assays under various stresses (acid, bile, oxidative stress) would reveal potential contributions to bacterial persistence in host environments. Additionally, potential interactions with host immune components should be investigated through binding studies with pattern recognition receptors or antimicrobial peptides.

What is the relationship between YeaL and other virulence factors in Salmonella pathogenesis?

Research into YeaL's relationship with established Salmonella virulence factors should employ a multi-faceted approach. Co-expression analysis can identify virulence factors with similar expression patterns under various conditions. Genetic interaction studies, particularly genetic epistasis experiments, may reveal functional relationships with known virulence systems like Type III secretion systems or Vi capsular polysaccharide. The Vi capsular polysaccharide, encoded by the viaB locus (10 genes), is a significant virulence factor that enables immune evasion in Salmonella infections . While direct evidence linking YeaL to Vi polysaccharide production is not established, membrane proteins often support virulence factor assembly or transport. Investigations could explore whether YeaL influences membrane composition or integrity in ways that affect virulence factor deployment or function. Comparative proteomic analysis of membrane fractions from wild-type and ΔyeaL mutants could identify alterations in virulence factor localization or abundance, potentially revealing functional connections between YeaL and established virulence mechanisms.

How can structural biology approaches be utilized to elucidate YeaL's molecular function?

Structural characterization of YeaL presents challenges common to membrane proteins but would significantly advance understanding of its function. Researchers should consider a tiered approach beginning with computational predictions using programs like TMHMM or Phyre2 to identify transmembrane domains and potential structural motifs. For experimental structure determination, three complementary approaches should be considered: X-ray crystallography requiring detergent-solubilized, highly purified protein followed by crystallization screening; cryo-electron microscopy, which may be advantageous for membrane proteins resistant to crystallization; and NMR spectroscopy for investigating dynamic regions and protein-ligand interactions. Site-directed mutagenesis of predicted functional residues coupled with activity assays would validate structure-function relationships. Additionally, molecular dynamics simulations can provide insights into YeaL's behavior within the membrane environment, particularly regarding conformational changes that might occur during potential transport cycles or protein-protein interactions within the bacterial membrane.

What role might YeaL play in antimicrobial resistance mechanisms in Salmonella paratyphi B?

Investigation of YeaL's potential contribution to antimicrobial resistance requires systematic experimental approaches. Comparative minimum inhibitory concentration (MIC) determinations between wild-type and ΔyeaL strains against multiple antibiotic classes would reveal whether YeaL affects drug susceptibility patterns. Membrane proteins can contribute to resistance through altered membrane permeability, efflux pump function, or stress response mechanisms . Time-kill kinetics experiments would provide dynamic information about how YeaL affects the rate of bacterial killing by antibiotics. Researchers should also examine whether exposure to sub-inhibitory antibiotic concentrations alters yeaL expression, which would suggest involvement in adaptive responses. Cases of S. Paratyphi B infections have required extended antibiotic treatment, suggesting potential resistance mechanisms involving membrane components . If YeaL affects resistance, molecular explanations should be sought through membrane permeability assays, studies of potential interactions with known efflux systems, and investigation of YeaL's impact on bacterial stress responses to antibiotic exposure.

How does the structure and function of YeaL compare between different Salmonella strains?

A comparative analysis of YeaL across Salmonella strains reveals important evolutionary patterns. The table below summarizes key characteristics across major Salmonella serovars:

This remarkable conservation suggests essential functional roles in Salmonella biology. Research approaches should include phylogenetic analysis of YeaL across more diverse Salmonella isolates, complementation studies to determine functional interchangeability between serovars, and comparative phenotypic analysis of yeaL mutants from different serovars to identify any serovar-specific functions . The identical sequence between S. paratyphi A and B YeaL proteins (despite significant genomic diversity between these serovars) particularly warrants investigation into selective pressures maintaining this conservation.

What experimental designs are most appropriate for studying YeaL's role in Salmonella infection models?

Robust experimental designs for investigating YeaL's role in infection should incorporate multiple approaches and appropriate controls. Cell culture infection models using intestinal epithelial cell lines (Caco-2, HT-29) can assess whether YeaL affects adhesion, invasion, or intracellular survival by comparing wild-type and ΔyeaL mutant strains. Complementation experiments reintroducing yeaL (both native and tagged versions) are essential to confirm phenotypic observations are specifically attributable to YeaL function. For in vivo studies, mouse models of infection represent the gold standard, but researchers must carefully select appropriate strains that develop symptomatic infection with S. paratyphi B. Competitive index assays, where wild-type and mutant strains are co-administered, provide sensitive measurements of relative fitness in vivo. Time-course experiments with tissue collection at multiple intervals post-infection can reveal whether YeaL affects specific stages of pathogenesis . Researchers should consider conditional expression systems to study potential essentiality of YeaL and employ both genetic (RNA-seq) and proteomic approaches to identify compensatory mechanisms activated in ΔyeaL mutants during infection.

How might cross-disciplinary approaches enhance our understanding of YeaL function in pathogenesis?

Integrating methods from multiple disciplines can provide comprehensive insights into YeaL's biological role. Systems biology approaches, particularly network analysis combining transcriptomic, proteomic, and metabolomic data, can position YeaL within broader cellular pathways. Computational biology enables molecular docking studies to predict potential binding partners or substrates. Structural biology methods like hydrogen-deuterium exchange mass spectrometry can identify dynamic regions of YeaL potentially involved in conformational changes or protein-protein interactions. Immunological approaches, including examining host immune responses to YeaL during infection, could reveal whether this protein is immunogenic or involved in immune evasion . Single-cell technologies can determine whether YeaL expression is heterogeneous within bacterial populations during infection, potentially identifying distinct bacterial subpopulations with specialized roles. Finally, incorporating clinical microbiology perspectives by examining yeaL sequence variations in clinical isolates associated with different disease severities could reveal correlations between YeaL variants and pathogenic potential in human hosts .