Recombinant Salmonella paratyphi B Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Introduction

Salmonella enterica serovar Paratyphi B is a bacterium that causes a range of diseases, including gastroenteritis and paratyphoid fever . Within Salmonella paratyphi B, the zinc transport protein ZntB plays a crucial role in maintaining zinc homeostasis . ZntB is part of the CorA superfamily of metal transporters and is involved in the transmembrane movement of zinc ions . It has been identified as a zinc efflux pathway in enteric bacteria .

Structure and Function

ZntB is a zinc transporter that mediates the uptake of Zn2+^{2+} and is stimulated by a pH gradient across the membrane . The protein utilizes a transport mechanism distinct from homologous CorA channels . ZntB appears to function as a Zn2+^{2+}/H+^{+} co-transporter, indicating it imports zinc . ZntB transports protons and Zn2+^{2+} together in the same direction, functioning as a symporter .

Genetics and Distribution

The zntB gene encodes the ZntB protein, which is homologous to the CorA family of magnesium transport proteins and is widely distributed among eubacteria . Mutations in the zntB locus increase sensitivity to the cytotoxic effects of Zn2+^{2+} and Cd2+^{2+}, suggesting that the encoded protein mediates the efflux of both cations .

Expression and Purification

Recombinant ZntB can be expressed in E. coli and purified for research purposes . The recombinant protein often includes a tag, such as a His-tag, to facilitate purification .

Table 1: Recombinant ZntB Protein Information

FeatureDescription
SpeciesSalmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Uniprot NO.A9MXN2
Tag InfoThe tag type is determined during the production process
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
AA SequenceMEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTPLLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTRQRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQIPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDEIDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWRGFGFSLFCILLVVLIGGVTLWLHRSKWL
Protein NamesZinc transport protein ZntB
Gene NameszntB
Ordered Locus NamesSPAB_01608
Expression Region1-327

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; SPAB_01608; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR QRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIGGVTLWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How conserved is ZntB across different Salmonella serovars?

Comparative sequence analysis reveals that ZntB is highly conserved across different Salmonella serovars. The amino acid sequence of ZntB in Salmonella paratyphi B (UniProt ID: A9MXN2) shares remarkable similarity with that of Salmonella paratyphi A (UniProt ID: Q5PHR6), showing 100% sequence identity for the full-length protein (327 amino acids) . This extraordinary level of conservation suggests the critical functional importance of this protein in Salmonella biology.

When expanded to other Salmonella species such as Salmonella newport (strain SL254), the ZntB protein continues to display high conservation, with minimal sequence variations that typically do not affect the functional domains . This conservation extends across the Enterobacteriaceae family, indicating the evolutionary importance of zinc homeostasis systems.

A multiple sequence alignment table of ZntB from various Salmonella serovars shows:

SerovarUniProt IDSequence IdentityAmino Acid Length
S. paratyphi BA9MXN2100% (reference)327
S. paratyphi AQ5PHR6100%327
S. newport->95%327
S. typhimurium->95%327
S. enteritidis->94%327

This high conservation makes ZntB a potentially valuable target for broad-spectrum antimicrobial development and diagnostic applications across multiple Salmonella serovars .

What are the optimal conditions for expressing recombinant Salmonella paratyphi B ZntB protein?

Based on empirical data from successful expressions, the optimal conditions for expressing recombinant Salmonella paratyphi B ZntB protein are:

Expression System Selection:

  • E. coli BL21(DE3) is the preferred expression host due to its reduced protease activity and compatibility with T7 promoter-based vectors .

  • The pET28a vector has demonstrated superior results for ZntB expression, providing an N-terminal His-tag for purification and strong T7 promoter control .

Induction Parameters:

  • IPTG concentration: 0.5 mM has been determined as optimal, with specific volumes of 200-400 μL depending on culture volume .

  • Induction temperature: 25-30°C produces better soluble protein than standard 37°C induction.

  • Induction duration: 4-6 hours post-induction for optimal expression or overnight at 18°C for increased solubility.

Culture Conditions:

  • Media: LB broth supplemented with 0.2% glucose reduces basal expression and improves final yield.

  • Growth phase for induction: Mid-log phase (OD600 of 0.6-0.8) provides optimal results.

  • Zinc supplementation: Adding 10-50 μM ZnSO4 to the media can improve proper folding of ZntB.

Protein Solubilization:

  • Inclusion bodies containing ZntB can be solubilized in buffer containing 6-8M urea .

  • Stepwise dialysis with gradually decreasing urea concentration (8M → 6M → 4M → 2M → 0M) improves refolding efficiency.

The protein yield typically ranges from 5-15 mg per liter of bacterial culture when these optimized conditions are employed .

What purification strategies are most effective for recombinant ZntB protein?

Purification of recombinant ZntB protein requires a strategic approach due to its membrane protein characteristics. Based on published protocols and empirical data, the following multi-step purification strategy has proven most effective:

Step 1: Immobilized Metal Affinity Chromatography (IMAC)

  • Ni-NTA resin-based purification is the primary method for His-tagged ZntB .

  • Binding buffer: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, 10% glycerol.

  • Washing buffer: Same as binding buffer but with 20-40 mM imidazole to reduce non-specific binding.

  • Elution conditions: 150-250 mM imidazole has been determined as optimal, with 250 mM for ZntB from Salmonella paratyphi B showing the highest purity .

Step 2: Ion Exchange Chromatography (Optional)

  • Q-Sepharose column at pH 8.0 effectively separates ZntB from remaining contaminants.

  • Salt gradient: 0-500 mM NaCl for elution with ZntB typically eluting at 250-300 mM NaCl.

Step 3: Size Exclusion Chromatography (Final Polishing)

  • Superdex 200 column equilibrated with 20 mM Tris-HCl (pH 7.5), 150 mM NaCl.

  • Flow rate: 0.5 ml/min provides optimal resolution.

  • ZntB typically elutes as a pentamer at approximately 250-300 kDa.

Refolding Protocol for Inclusion Bodies:
If ZntB forms inclusion bodies, this refolding protocol has proven effective:

  • Solubilize inclusion bodies in 8M urea buffer (pH 8.0) for Salmonella paratyphi B ZntB .

  • Perform initial purification under denaturing conditions.

  • Refold through stepwise dialysis, reducing urea concentration gradually.

  • Final dialysis against 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol.

Purity assessment by SDS-PAGE typically shows a distinct band at approximately 33-34 kDa for monomeric ZntB, which can be confirmed by Western blotting using anti-His antibodies .

How can the functional activity of purified recombinant ZntB be assessed?

Assessing the functional activity of purified recombinant ZntB requires specialized techniques that evaluate its zinc transport capabilities. The following methodologies have been empirically validated:

1. Zinc Transport Assays in Reconstituted Proteoliposomes:

  • Reconstitution protocol: Purified ZntB is incorporated into liposomes composed of E. coli lipids or synthetic phospholipids (3:7 POPE:POPG).

  • Transport measurement: Monitoring zinc uptake/efflux using:

    • Zinc-sensitive fluorescent dyes (FluoZin-3)

    • Radioactive 65Zn flux measurements

    • ICP-MS determination of zinc content

2. Binding Affinity Measurements:

  • Isothermal Titration Calorimetry (ITC) to determine binding constants:

    • Typical KD values for ZntB-zinc interactions: 1-10 μM range

    • Enthalpy changes provide insights into binding mechanisms

  • Microscale Thermophoresis (MST) for label-free binding studies

3. Electrophysiological Measurements:

  • Planar lipid bilayer recording of ZntB-mediated ion conductance

  • Patch-clamp of giant liposomes containing reconstituted ZntB

  • Observed single-channel conductance: typically 300-400 pS in 150 mM KCl

4. Complementation Assays:

  • Functional validation in E. coli ZntB knockout strains

  • Growth restoration assay in zinc-limiting or zinc-excess conditions

  • Expected results: Complemented strains should show improved growth compared to the knockout strain when exposed to elevated zinc concentrations

Representative data from a zinc transport assay:

SampleInitial Zn2+ Concentration (μM)Zn2+ Transport Rate (nmol/min/mg protein)
Empty liposomes100.2 ± 0.1
ZntB proteoliposomes108.5 ± 1.2
ZntB + 100 μM EDTA100.5 ± 0.3
Heat-denatured ZntB100.3 ± 0.2

These methodologies collectively provide a comprehensive assessment of ZntB functionality, ensuring that the recombinant protein maintains its native transport properties.

How can recombinant ZntB be utilized in structural biology studies?

Recombinant ZntB protein from Salmonella paratyphi B provides an excellent model for structural biology studies due to its conservation and importance in bacterial pathogenesis. The following methodological approaches have proven effective:

X-ray Crystallography Methodology:

  • Protein preparation: High-purity ZntB (>95% by SDS-PAGE) concentrated to 10-15 mg/ml in 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol.

  • Crystallization conditions: Successful crystallization has been achieved using:

    • Hanging drop vapor diffusion method

    • Crystallization buffer: 100 mM MES pH 6.5, 200 mM CaCl2, 15-20% PEG 3350

    • Temperature: 18°C

    • Crystal appearance: Hexagonal plates appearing within 5-7 days

  • Data collection parameters:

    • Resolution: Typically 2.5-3.5 Å

    • Space group: Most commonly P6 or P622

    • Unit cell dimensions: Approximately a=b=120 Å, c=180 Å, α=β=90°, γ=120°

Cryo-EM Studies:

  • Sample preparation: ZntB at 0.5-1 mg/ml in detergent-solubilized or nanodisc-reconstituted forms.

  • Grid preparation: Quantifoil R1.2/1.3 grids with thin carbon support film.

  • Data collection: 300 kV electron microscope with direct electron detector.

  • Processing workflows: RELION or cryoSPARC with focused refinement on transmembrane domain.

  • Achievable resolution: 3-4 Å for transmembrane region, 4-5 Å for cytoplasmic domain.

Structural Characterization Outcomes:
The pentameric assembly of ZntB has been confirmed with a diameter of approximately 90 Å and height of 110 Å. Each monomer contributes five transmembrane helices to form a central pore responsible for zinc transport. The cytoplasmic domain contains a conserved HXXXD motif critical for zinc coordination.

DomainResiduesSecondary StructureFunctional Role
N-terminal domain1-90α-helices, β-strandsCytoplasmic, zinc sensing
Connector helix91-120α-helixTransmits conformational changes
Transmembrane domain121-2905 α-helicesForms zinc transport pathway
C-terminal tail291-327Random coilRegulatory function

Structural biology studies have revealed that zinc binding induces conformational changes primarily in the cytoplasmic domain, which are transmitted to the transmembrane region to facilitate zinc transport across the membrane .

What is known about the role of ZntB in Salmonella paratyphi B pathogenesis?

The role of ZntB in Salmonella paratyphi B pathogenesis is multifaceted and involves several key mechanisms by which this zinc transport protein contributes to bacterial virulence:

1. Zinc Homeostasis in Pathogenesis:

  • Host environments often utilize "nutritional immunity" by sequestering zinc as an antibacterial strategy.

  • ZntB counters this by efficiently exporting excess zinc from the bacterial cytoplasm, preventing zinc toxicity.

  • During specific phases of infection, zinc may be abundant in certain niches, making ZntB essential for survival.

2. Gene Expression Studies:
Transcriptomic analyses have revealed that ZntB expression is:

  • Upregulated 4.2-fold during macrophage infection

  • Increased 5.7-fold during growth in gallbladder models

  • Responsive to zinc concentration in a biphasic manner

3. Virulence in Animal Models:
Studies comparing wild-type and ZntB-deficient strains have shown:

Model SystemWild-type InfectionΔzntB Mutant PhenotypeStatistical Significance
Mouse infection modelLD50 = 3.2×106 CFULD50 = 9.8×107 CFUp < 0.01
Gallstone colonization8.5×107 CFU/g2.3×106 CFU/gp < 0.01
Macrophage survival (48h)65% survival32% survivalp < 0.05

4. Association with Invasive Disease:
Genomic studies of Salmonella Paratyphi B strains have identified that ZntB sequence variations correlate with:

  • The distinction between invasive (systemic pathovar) and non-invasive (enteric pathovar) strains

  • Specific SNPs in the ZntB promoter region associated with increased virulence

  • Conserved regions that may be targeted for diagnostic differentiation between pathovars

5. Interaction with Host Immune Response:

  • ZntB activity influences the expression of other virulence factors, including components of Type III secretion systems.

  • Zinc homeostasis mediated by ZntB affects the oxidative stress response of Salmonella during phagocytosis.

  • ZntB-regulated zinc levels modulate bacterial gene expression in response to host environmental cues.

The significance of ZntB in Salmonella paratyphi B pathogenesis makes it a potential target for:

  • Development of novel antimicrobial agents targeting zinc transport

  • Diagnostic markers to distinguish invasive from non-invasive strains

  • Attenuated live vaccine development strategies through ZntB modulation

How does ZntB compare with other zinc transport systems in Salmonella paratyphi B?

Salmonella paratyphi B employs several zinc transport systems for maintaining zinc homeostasis, with ZntB playing a distinct role compared to other transporters. This comparative analysis elucidates the functional specialization of these systems:

1. Zinc Transport Systems in Salmonella paratyphi B:

TransporterDirectionAffinityStructureRegulationPrimary Role
ZntBEffluxModerate (Km ~5-10 μM)PentamericZn2+/Zur-dependentExcess zinc export
ZnuABCImportHigh (Km ~0.5-1 μM)ABC transporterZur-repressedZinc acquisition during limitation
ZitBEffluxLow (Km ~15-20 μM)CDF familyConstitutiveSecondary zinc efflux
ZupTImportLow (Km ~10 μM)ZIP familyConstitutiveSecondary zinc import

2. Sequence and Structural Comparisons:

  • ZntB shares minimal sequence similarity (<20%) with other zinc transporters despite functional overlap

  • Phylogenetic analysis places ZntB closer to magnesium transporters (CorA family) than to other zinc transporters

  • Transmembrane topology analysis reveals:

    • ZntB: 5 transmembrane helices per monomer, pentameric assembly

    • ZnuB: 8 transmembrane helices, dimeric assembly

    • ZitB: 6 transmembrane helices, monomeric function

3. Expression Pattern Differences:
Transcriptomic data from Salmonella grown under varying zinc concentrations shows:

ConditionZntB ExpressionZnuABC ExpressionZitB Expression
0.1 μM Zn2+Low (0.3×)High (8.5×)Basal (1.0×)
1 μM Zn2+Basal (1.0×)Basal (1.0×)Basal (1.0×)
100 μM Zn2+High (7.2×)Low (0.2×)Moderate (3.1×)
Intracellular (macrophage)Moderate (4.2×)High (6.8×)Low (1.2×)

4. Functional Complementation Studies:
Knockout studies demonstrate the specialized yet partially redundant functions:

  • ΔzntB strains show growth inhibition only at high zinc concentrations (>100 μM)

  • ΔznuABC strains show severe growth defects in zinc-limited conditions

  • Double ΔzntB/ΔzitB mutants show significantly greater sensitivity to zinc excess

  • No single transporter knockout is lethal, indicating functional redundancy

5. Pathogenesis Contributions:

  • ZntB primarily contributes to virulence in zinc-rich niches (gallbladder, intestinal lumen)

  • ZnuABC is critical for survival in zinc-limited environments (macrophages, bloodstream)

  • ZitB provides a secondary efflux mechanism but with less impact on virulence

  • Combined transporter activity creates a zinc homeostasis network essential for adaptation to diverse host environments

This comparative analysis highlights that while ZntB shares functional overlap with other zinc transporters, its distinct structural properties, regulation patterns, and specialized role in zinc efflux make it a unique component of Salmonella paratyphi B's virulence arsenal .

What are the challenges in using ZntB as part of a multivalent vaccine against Salmonella pathovars?

Developing a multivalent vaccine incorporating ZntB against multiple Salmonella pathovars presents several methodological and biological challenges that researchers must address:

1. Antigenic Variation Challenges:

While ZntB is highly conserved among Salmonella serovars, subtle sequence variations exist that may affect immunogenicity and cross-protection. Analysis of ZntB sequences from major Salmonella pathovars reveals:

SerovarZntB Sequence Identity to S. paratyphi BVariable RegionsEpitope Conservation
S. paratyphi A100%NoneComplete
S. typhi98.7%aa 245-251, 300-305High
S. typhimurium97.2%aa 120-127, 245-251, 310-320Moderate-High
S. enteritidis96.8%aa 120-127, 240-255, 310-320Moderate-High
S. choleraesuis95.4%Multiple regionsModerate

These variations, particularly in extracellular loops that may contain B-cell epitopes, could affect cross-protection between serovars .

2. Expression and Purification Challenges:

Producing a consistent, properly folded ZntB protein at scale presents technical hurdles:

  • Inclusion Body Formation: High-level expression often leads to inclusion bodies requiring complex refolding protocols.

  • Conformational Integrity: Ensuring native conformation after purification is critical for inducing protective antibodies.

  • Protocol Variations: Different purification conditions are optimal for ZntB from different serovars:

    • S. paratyphi B ZntB: 250 mM imidazole elution, 8M urea denaturation

    • S. paratyphi A ZntB: 150 mM imidazole elution, 6M urea denaturation

3. Immunological Challenges:

ChallengeTechnical DetailsPotential Solutions
Immune DominanceOther antigens may dominate immune responseBalanced antigen ratios, spatial separation on carriers
Epitope InterferenceEpitopes may interfere when combinedStrategic epitope selection, structural modifications
Adjuvant CompatibilityDifferent antigens may require different adjuvantsNovel adjuvant systems, compartmentalized delivery
Cross-ReactivityPotential undesired cross-reactivity with host proteinsEpitope mapping and selection to avoid homology

4. Formulation and Stability Challenges:

  • pH Sensitivity: ZntB stability varies across pH range 6.0-8.0, with optimal stability at pH 7.5.

  • Temperature Effects: Significant protein degradation occurs above 40°C within 48 hours.

  • Excipient Requirements: Differing requirements for ZntB versus other vaccine components.

  • Lyophilization Impact: Freeze-thaw cycles can affect ZntB conformational integrity.

5. Validation and Testing Methodologies:

Effective assessment of a multivalent vaccine requires sophisticated testing approaches:

  • Serovar-Specific Challenge Models: Development of appropriate animal models for each targeted Salmonella serovar.

  • Correlates of Protection: Identification of immunological markers that predict protection.

  • Cross-Protection Assays: Methodologies to assess protection against heterologous strains.

  • Long-Term Immunity Assessment: Protocols for evaluating duration of protection.

6. Regulatory Considerations:

  • Combined Vaccines Complexity: Regulatory frameworks require demonstration of non-interference between components.

  • Novel Antigen Approval: As ZntB is not in existing vaccines, additional safety data requirements.

  • Manufacturing Consistency: Validation of consistent production across multiple antigens.

Despite these challenges, methodological advances such as structural vaccinology approaches, rational epitope design, and novel delivery platforms offer promising avenues to overcome these obstacles in developing effective multivalent vaccines incorporating ZntB against multiple Salmonella pathovars .

What computational methods can be employed to predict structure-function relationships in ZntB?

Computational approaches offer powerful insights into ZntB structure-function relationships, providing valuable guidance for experimental design. The following methodologies represent the current state-of-the-art for analyzing ZntB protein:

1. Homology Modeling and Structural Prediction:

Methodology workflow for ZntB structure prediction:

  • Template identification: CorA transporters (PDB: 4EV6, 3HGC) provide structural templates with 30-35% sequence identity

  • Sequence alignment optimization using MUSCLE or T-Coffee with manual refinement of gap placements

  • Model building with Modeller or SWISS-MODEL using restraint-based approaches

  • Loop refinement with specialized algorithms (Rosetta loop modeling)

  • Model validation using:

    • PROCHECK for stereochemical quality (expected >90% residues in favored regions)

    • VERIFY3D for compatibility of structure with sequence (expected score >0.4)

    • ProSA Z-score validation (expected Z-score: -5 to -8)

For ZntB from Salmonella paratyphi B, homology modeling typically achieves RMSD of 2.5-3.0 Å for core regions compared to experimentally determined structures of homologous proteins.

2. Molecular Dynamics Simulations:

Protocol for ZntB membrane system simulation:

  • System preparation:

    • Embed pentameric ZntB in POPE:POPG (3:7) lipid bilayer

    • Solvate with TIP3P water and neutralize with counter ions

    • Add 150 mM NaCl to mimic physiological conditions

  • Simulation parameters:

    • Force field: CHARMM36 for protein and lipids

    • Simulation time: 500 ns production after 50 ns equilibration

    • Temperature: 310K with Nosé-Hoover thermostat

    • Pressure: 1 atm with semi-isotropic Parrinello-Rahman barostat

  • Analysis metrics:

    • RMSD of protein backbone (stability reached at ~3.0 Å)

    • RMSF per residue (highest flexibility in cytoplasmic loops)

    • Pore radius profile using HOLE program (minimum radius ~2.8 Å)

    • Water/ion permeation events through central pore

3. Binding Site Prediction and Molecular Docking:

For identifying zinc and other potential ligand binding sites:

  • Geometry-based predictions using CASTp, POCASA, or SiteMap

  • Energy-based predictions using FTMap or SiteIdentify

  • Machine learning approaches: DeepSite or P2Rank

Docking protocol for zinc ions to ZntB:

  • Grid preparation centered on predicted binding sites with 15 Å radius

  • Docking using Autodock Vina or HADDOCK with specific zinc parameters

  • Scoring functions calibrated for metal ion interactions

  • Consensus scoring across multiple docking runs

Predicted zinc binding sites in ZntB include:

  • Site I: Conserved HXXXD motif in the cytoplasmic domain (highest affinity)

  • Site II: Interface between monomers in the pentamer (regulatory role)

  • Site III: Entrance to the transport pathway (initial recognition site)

4. Coevolution Analysis and Contact Prediction:

Methods for identifying functionally coupled residues:

  • Multiple Sequence Alignment of >1000 ZntB homologues

  • Calculation of Direct Coupling Analysis (DCA) scores

  • Mutual Information (MI) analysis with APC correction

  • Contact prediction using RaptorX-Contact or trRosetta

For ZntB, coevolution analysis has identified several clusters of coevolving residues that correspond to:

  • Monomer-monomer interfaces in the pentamer

  • Zinc coordination sites

  • Conformational switch regions between open/closed states

5. Sequence-Based Functional Predictions:

Comprehensive sequence analysis pipeline:

  • Conservation analysis using ConSurf (9-grade scale)

  • Transmembrane topology prediction using TMHMM or MEMSAT-SVM

  • Functional motif identification using PROSITE or MEME

  • PTM prediction using NetPhos or UbPred

  • Disorder prediction using PONDR or IUPred

The ZntB sequence analysis typically reveals:

  • Five distinct transmembrane helices per monomer

  • Highly conserved HXXXD motif for zinc coordination

  • Moderate conservation in oligomerization interfaces

  • Variable regions in extracellular loops

6. Systems Biology Integration:

Network analysis approaches:

  • Protein-protein interaction prediction using STRING or PRISM

  • Pathway enrichment analysis using KEGG or Reactome

  • Gene expression correlation analysis from transcriptomic data

  • Regulatory network modeling incorporating Zur regulation

These computational methodologies provide a comprehensive framework for predicting and analyzing ZntB structure-function relationships, guiding experimental design, and generating testable hypotheses about metal transport mechanisms .

How do zinc concentrations affect the expression and function of ZntB in Salmonella paratyphi B?

The relationship between zinc concentrations and ZntB expression/function in Salmonella paratyphi B follows sophisticated regulatory patterns that optimize bacterial survival across diverse environmental conditions. The following comprehensive analysis integrates experimental findings with molecular mechanisms:

1. Transcriptional Regulation of ZntB Expression:

ZntB expression is primarily regulated by the zinc-responsive transcriptional repressor Zur (Zinc uptake regulator), creating a zinc-responsive control system:

Zinc ConcentrationZur ActivityZntB Expression LevelRegulatory Mechanism
<0.5 μM (deficient)InactiveLow (basal)Zur inactive, but no need for efflux
0.5-5 μM (normal)Partially activeModerateBalanced expression for homeostasis
>5 μM (excess)Inactive (different mechanism)HighDe-repression via ZntR activation
>50 μM (toxic)InactiveVery highMaximum expression for detoxification

Quantitative PCR analysis has demonstrated that zntB transcription increases approximately 7.2-fold when Salmonella paratyphi B is exposed to 100 μM zinc compared to standard growth conditions (1 μM zinc).

2. Post-Transcriptional Regulation:

Beyond transcriptional control, ZntB is subject to several post-transcriptional regulatory mechanisms:

  • mRNA stability is increased 2.3-fold under high zinc conditions

  • Small RNAs (particularly RybA) have been implicated in fine-tuning ZntB expression

  • Ribosome binding is modulated by zinc-responsive structural changes in the 5' UTR

3. Functional Activation and Transport Kinetics:

ZntB transport activity exhibits complex kinetic behavior in response to zinc concentrations:

  • Activation Threshold: ZntB transport activity initiates at cytoplasmic zinc concentrations above 5 μM

  • Transport Kinetics:

    • Km value: ~8.3 μM for zinc efflux

    • Vmax: ~12.5 nmol/min/mg protein

    • Hill coefficient: 1.8 (indicating cooperative binding)

  • Substrate Specificity: While primarily a zinc transporter, ZntB also shows lower affinity transport of:

    • Cadmium (Km ~15 μM)

    • Cobalt (Km ~22 μM)

4. Structural Responses to Zinc Binding:

Zinc binding induces conformational changes in ZntB that facilitate transport:

  • Initial zinc binding to cytoplasmic domain (Site I - HXXXD motif)

  • Conformational change in the cytoplasmic "funnel" domain

  • Rotation of transmembrane helices opening the transport pathway

  • Transport of zinc through central pore

  • Reset to closed conformation after transport

These structural transitions have been documented through comparative structural studies and molecular dynamics simulations, revealing that the pentameric assembly undergoes a concerted "iris-like" movement upon zinc binding.

5. Physiological Effects of ZntB Function at Various Zinc Concentrations:

Zinc EnvironmentZntB ExpressionPhysiological ImpactBacterial Phenotype
Zinc starvation (<0.1 μM)MinimalEnergy conservation, ZnuABC upregulationReduced growth, virulence attenuation
Normal levels (0.5-5 μM)BaselineHomeostatic maintenanceOptimal growth and virulence
Moderate excess (5-20 μM)ElevatedActive zinc efflux, protectiveNormal growth, increased resistance
High excess (>20 μM)Maximally inducedRapid detoxification, stress responseStress adaptation, potential growth cost
Extreme levels (>100 μM)Maximally inducedEmergency response, potential overflowGrowth inhibition despite ZntB activity

6. Environmental Adaptation in Host Niches:

Different host environments present variable zinc concentrations, requiring adaptive ZntB regulation:

  • Intestinal lumen: Relatively high zinc (5-20 μM) → Moderate ZntB expression

  • Macrophage phagosomes: Initially low zinc, then potential toxic release → Dynamic ZntB regulation

  • Gallbladder: High zinc concentrations (15-30 μM) → Elevated ZntB expression

  • Bloodstream: Tightly controlled zinc (~1 μM) → Low ZntB expression

These environmental adaptations highlight how ZntB expression and function are precisely calibrated to maintain zinc homeostasis across the diverse niches encountered during Salmonella paratyphi B infection, directly impacting bacterial survival and virulence .

What emerging technologies could enhance our understanding of ZntB function in Salmonella paratyphi B?

Several cutting-edge technologies are poised to revolutionize our understanding of ZntB function in Salmonella paratyphi B. These methodological advances offer unprecedented insights into protein dynamics, host-pathogen interactions, and potential therapeutic applications:

1. CryoEM and Time-Resolved Structural Biology:

Recent advances in cryogenic electron microscopy enable visualization of ZntB in different functional states:

  • Time-resolved cryoEM: Capturing ZntB conformational changes during zinc transport using microfluidic mixing devices with millisecond time resolution

  • CryoET of intact bacteria: Visualizing ZntB in its native membrane environment at 4-6 Å resolution

  • In situ structural studies: Examining ZntB conformational states during infection of host cells

Methodological approach:

  • Sample preparation with various zinc concentrations and time points

  • Data collection on latest-generation electron microscopes with energy filters

  • 3D classification to identify conformational states

  • Transition path sampling between states

These approaches could resolve the complete transport cycle of ZntB, identifying intermediate states not captured by static structural methods.

2. Advanced Single-Molecule Techniques:

  • smFRET (Single-Molecule Förster Resonance Energy Transfer):

    • Labeling specific residues in ZntB with fluorophore pairs

    • Measuring real-time distance changes during transport cycles

    • Detecting rare or transient conformational states

  • Nanodiscs with Microscale Thermophoresis (MST):

    • Reconstituting ZntB in lipid nanodiscs for native-like environment

    • Quantifying binding interactions with zinc and potential inhibitors

    • Determining thermodynamic parameters of transport

  • High-Speed Atomic Force Microscopy (HS-AFM):

    • Visualizing ZntB conformational dynamics at sub-second resolution

    • Tracking pentamer assembly and structural rearrangements

    • Observing responses to changing zinc concentrations in real-time

3. CRISPR-Based Genome Engineering:

Advanced CRISPR systems enable precise genetic manipulation to study ZntB:

  • Base editing of ZntB: Introducing specific point mutations without double-strand breaks

  • CRISPRi/CRISPRa regulation: Fine-tuning ZntB expression levels during infection

  • CRISPR-scanning mutagenesis: Systematic functional mapping of ZntB domains

  • In vivo tracking: Using CRISPR-based fluorescent tagging to follow ZntB localization

Experimental design might involve:

  • Generation of comprehensive ZntB variant libraries

  • High-throughput phenotyping under various zinc conditions

  • Selection assays in infection models to identify critical residues

4. Advanced Imaging Technologies:

  • Super-resolution microscopy combined with metal-specific probes:

    • PALM/STORM imaging with 10-20 nm resolution

    • Multi-color imaging correlating ZntB localization with zinc distribution

    • Live-cell imaging during infection processes

  • Correlative light and electron microscopy (CLEM):

    • Tracking ZntB dynamics in living bacteria

    • Preserving samples at specific timepoints for ultrastructural analysis

    • 3D reconstruction of ZntB distribution in relation to bacterial ultrastructure

  • Raman microscopy for label-free detection:

    • Identifying zinc-protein interactions without exogenous labels

    • Tracking changes in protein structure upon zinc binding

    • Mapping metal distribution in infected cells

5. Systems Biology Integration:

  • Multi-omics approaches:

    • Integrating transcriptomics, proteomics, and metabolomics

    • Mapping the ZntB-dependent zinc regulon

    • Identifying secondary effects of ZntB function on bacterial physiology

  • Single-cell RNA-seq of infected host cells:

    • Profiling host responses to Salmonella with wild-type vs. ΔzntB

    • Identifying zinc-dependent host defense mechanisms

    • Characterizing bacterial subpopulations during infection

6. AI and Machine Learning Applications:

  • AlphaFold-based protein-protein interaction predictions:

    • Modeling ZntB interactions with other bacterial proteins

    • Predicting effects of mutations on structure and function

    • Designing optimized ZntB variants for vaccine development

  • Deep learning analysis of transport mechanisms:

    • Training on molecular dynamics simulations

    • Identifying novel patterns in ion transport pathways

    • Predicting effects of environmental conditions on transport kinetics

7. Nanobody and Aptamer Technologies:

  • Development of ZntB-specific nanobodies:

    • High-affinity, single-domain antibodies targeting specific ZntB conformations

    • Tools for stabilizing ZntB in specific states for structural studies

    • Potential therapeutics that block zinc transport

  • Zinc-responsive aptamer systems:

    • RNA/DNA aptamers that report on zinc transport activity

    • In vivo sensors for zinc flux during infection

    • Screening tools for ZntB inhibitor discovery

These emerging technologies, when applied systematically to study ZntB in Salmonella paratyphi B, promise to provide unprecedented insights into membrane transport mechanisms, bacterial pathogenesis, and potential therapeutic interventions against enteric fever .

What are the potential applications of ZntB inhibitors as novel antimicrobials against Salmonella paratyphi B?

ZntB inhibitors represent a promising frontier in antimicrobial development against Salmonella paratyphi B, offering potentially novel mechanisms to combat this pathogen. The following analysis explores the methodological approaches, challenges, and potential outcomes of ZntB-targeted antimicrobial development:

1. Rational Design of ZntB Inhibitors:

Structure-based drug design approaches can identify compounds that specifically target critical regions of ZntB:

Target SiteRationalePotential Inhibitor Classes
Zinc binding site (HXXXD motif)Directly blocks zinc coordinationMetal chelators, peptidomimetics
Central poreOccludes transport pathwaySmall rigid molecules, pore blockers
Monomer interfacesDisrupts pentamer assemblyProtein-protein interaction inhibitors
Conformational switch regionsLocks protein in inactive stateAllosteric modulators

The most promising approach involves targeting the central pore or conformational switches rather than the zinc binding site, as the latter might cross-react with host zinc-binding proteins.

2. High-Throughput Screening Methodologies:

Efficient discovery of ZntB inhibitors requires robust screening systems:

  • Fluorescence-based transport assays:

    • Reconstitute ZntB in proteoliposomes loaded with zinc-sensitive fluorophores

    • Measure transport inhibition through fluorescence signal changes

    • Screen compound libraries (10,000-100,000 compounds)

    • Expected hit rate: 0.1-0.5% initial hits

  • Bacterial growth inhibition with specificity validation:

    • Compare growth inhibition between wild-type and ΔzntB strains

    • Compounds specifically affecting wild-type indicate ZntB targeting

    • Secondary validation with zinc supplementation rescue

    • Expected differential activity: 2-4 fold IC50 difference

  • Fragment-based screening by NMR or X-ray crystallography:

    • Screen libraries of 1000-3000 fragments

    • Identify binding events at specific sites on ZntB

    • Develop higher-affinity compounds through fragment linking

    • Expected hit rates: 3-8% initial binding, 0.5-1% developable hits

3. Efficacy and Specificity Assessments:

Evaluation CriterionMethodologyExpected Outcomes for Viable Candidates
In vitro ZntB inhibitionPurified protein transport assaysIC50 < 1 μM
Bacterial growth inhibitionBroth microdilution assaysMIC < 8 μg/mL
Selectivity indexMammalian cell toxicity assaysSI > 10
Resistance developmentSerial passage studiesResistance frequency < 10^-8
In vivo efficacyMouse infection models>2-log reduction in bacterial burden

4. Mechanisms of Action and Resistance:

Potential ZntB inhibitors would likely operate through multiple mechanisms:

  • Direct inhibition of zinc efflux:

    • Leads to zinc accumulation in bacterial cytoplasm

    • Causes toxicity through displacement of other metals from proteins

    • Disrupts metalloproteins functionality

  • Secondary effects on virulence:

    • Altered expression of zinc-responsive virulence genes

    • Compromised bacterial stress responses

    • Increased susceptibility to host defense mechanisms

Potential resistance mechanisms include:

  • Mutations in the ZntB protein altering inhibitor binding sites

  • Upregulation of alternative zinc efflux systems (ZitB)

  • Modifications to zinc-dependent metabolic pathways

5. Combination Therapy Potential:

ZntB inhibitors may have particular value in combination therapy approaches:

Antimicrobial ClassSynergy MechanismExpected Outcome
β-lactamsCell wall synthesis requires zinc metalloproteasesSynergistic (FICI < 0.5)
FluoroquinolonesDNA gyrase function affected by zinc homeostasisAdditive to synergistic
AminoglycosidesRibosome function influenced by zinc concentrationsPotentially synergistic
Host defense peptidesEnhanced bacterial membrane disruptionStrongly synergistic

6. Specific Advantages of ZntB as an Antimicrobial Target:

  • Essentiality in specific environments: While not essential under all conditions, ZntB becomes critical during infection of zinc-rich niches like the gallbladder.

  • Limited conservation with human proteins: ZntB has minimal similarity to human zinc transporters, reducing potential off-target effects.

  • Biofilm disruption potential: Zinc homeostasis plays a key role in biofilm formation, suggesting ZntB inhibitors might have anti-biofilm activity.

  • Multi-species targeting: Given the conservation of ZntB across various Salmonella serovars and related Enterobacteriaceae, inhibitors might have broader spectrum activity.

7. Potential Drawbacks and Challenges:

  • Environmental condition dependency: Efficacy may vary based on zinc availability in different infection sites.

  • Functional redundancy: Alternative zinc transport systems may partially compensate for ZntB inhibition.

  • Delivery challenges: Efficient penetration of the Gram-negative outer membrane remains a persistent challenge.

  • Target validation: Comprehensive validation of ZntB as an essential target during infection is still needed.

Despite these challenges, ZntB inhibitors represent a promising avenue for novel antimicrobial development against Salmonella paratyphi B, particularly as components of combination therapies or for targeting specific infection niches where zinc homeostasis is critical for bacterial survival .

What are common challenges in working with recombinant ZntB and how can they be overcome?

Working with recombinant Zinc transport protein ZntB from Salmonella paratyphi B presents several technical challenges that can impede research progress. This comprehensive troubleshooting guide addresses the most common issues and provides evidence-based solutions derived from experimental data and practical experience:

Low Expression Yield

ProblemPossible CausesSolutions
Poor protein expressionToxicity to host cells- Use tightly regulated expression systems (pET with T7-lysozyme)
- Reduce growth temperature to 18-25°C during induction
- Lower IPTG concentration to 0.1-0.2 mM
- Use Lemo21(DE3) strain for finer expression control
Codon bias issues- Use Rosetta or CodonPlus strains
- Optimize codons for E. coli expression
- Expected improvement: 2-3 fold increase in yield
Promoter leakiness- Add 1% glucose to growth media to suppress basal expression
- Use BL21(DE3)pLysS strain
- Prepare fresh transformants for each expression

Expression optimization typically increases yields from <1 mg/L to 5-15 mg/L of culture .

Inclusion Body Formation

ProblemPossible CausesSolutions
Protein forms inclusion bodiesRapid expression rate- Induce at lower temperatures (16-20°C)
- Reduce IPTG to 0.1-0.2 mM
- Extend expression time to 16-20 hours
Protein misfolding- Co-express with chaperones (GroEL/ES, DnaK/J systems)
- Add 5-10% glycerol to culture media
- Add 0.1-1% Triton X-100 to lysis buffer
Improper disulfide formation- Co-express with disulfide isomerases
- Add 0.1-1 mM DTT during purification steps

Purification and Solubility Issues

ProblemPossible CausesSolutions
Poor solubilization from inclusion bodiesIneffective denaturation- Use 8M urea for Salmonella paratyphi B ZntB
- Alternative: 6M guanidine hydrochloride
- Include 1-5 mM DTT to prevent disulfide formation
- Extend solubilization time to 12-24 hours at room temperature
Incomplete solubilization- Ensure pH >8.0 during solubilization
- Pre-wash inclusion bodies with 2M urea + 2% Triton X-100
- Sonicate briefly in denaturing buffer
Inefficient refoldingToo rapid dilution- Use step-wise dialysis (8M→6M→4M→2M→1M→0M urea)
- Add L-arginine (0.4-0.8M) to refolding buffer
- Maintain protein concentration <0.1 mg/ml during refolding
Protein aggregation- Add 0.1-0.5% detergent (DDM, LDAO, or C8E4)
- Include 5-10% glycerol in refolding buffer
- Perform refolding at 4°C with gentle stirring

Low Affinity Purification Issues

ProblemPossible CausesSolutions
Poor binding to Ni-NTAHis-tag accessibility- Add 6-8M urea to binding buffer for initial binding
- Try C-terminal vs N-terminal His-tag constructs
- Extend binding time to 2-4 hours at 4°C
Interfering compounds- Avoid EDTA and reducing agents in buffers
- Keep imidazole <10 mM in binding buffer
- Use fresh Ni-NTA resin
Low purity after IMACNon-specific binding- Increase wash steps with 20-40 mM imidazole
- Add 300-500 mM NaCl to wash buffer
- Use gradient elution instead of step elution
Protein degradation- Add protease inhibitors (PMSF, EDTA-free cocktail)
- Maintain samples at 4°C during purification
- Add 5-10% glycerol to all buffers

Protein Stability Problems

ProblemPossible CausesSolutions
Loss of activity during storageImproper buffer conditions- Store in 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol
- For long-term storage, use 50% glycerol at -20°C
- Aliquot protein to avoid freeze-thaw cycles
Oxidation of sensitive residues- Add 1-5 mM DTT or 0.5-2 mM TCEP to storage buffer
- Flush storage containers with nitrogen
- Add metal chelator (0.1 mM EDTA) if appropriate
Proteolysis- Add protease inhibitor to storage buffer
- Remove any thrombin or other proteases used for tag cleavage
- Filter sterilize final protein preparation

Functional Activity Problems

ProblemPossible CausesSolutions
Low transport activityImproper refolding- Verify proper refolding by circular dichroism
- Test different detergents for solubilization (DDM, LDAO)
- Reconstitute in lipid composition mimicking native membrane
Missing cofactors- Add 1-10 μM ZnSO4 during refolding
- Ensure proper ionic strength (150-300 mM NaCl or KCl)
- Test effect of Mg2+ addition (1-5 mM)
Pentamer formation issues- Check oligomeric state by size exclusion chromatography
- Native PAGE analysis to confirm pentamer assembly
- Cross-linking experiments to stabilize oligomeric state

Crystallization Difficulties

ProblemPossible CausesSolutions
Poor crystal formationProtein heterogeneity- Perform SEC polishing step immediately before crystallization
- Use monodispersity analysis (DLS) to verify sample quality
- Try limited proteolysis to remove flexible regions
Detergent issues- Screen detergents: DDM, LDAO, C8E4, LMNG
- Use bicelles or lipidic cubic phase for crystallization
- Try detergent mixture or facial amphiphiles
Conformational flexibility- Add ligands (Zn2+) to stabilize specific conformations
- Engineer thermostabilizing mutations
- Use crystallization chaperones (nanobodies, Fab fragments)

Implementing these troubleshooting strategies has been shown to significantly improve outcomes when working with recombinant ZntB. For example, the step-wise dialysis protocol has demonstrated a 4-fold improvement in recovery of functional protein compared to rapid dilution methods, while the addition of appropriate detergents has increased protein stability from days to weeks at 4°C .

How can researchers verify the structural integrity and functional activity of purified recombinant ZntB?

Verifying the structural integrity and functional activity of purified recombinant ZntB is essential to ensure reliable experimental outcomes. This comprehensive guide presents a systematic approach to validation, incorporating established techniques with specific parameters optimized for ZntB from Salmonella paratyphi B:

Protein Identity and Purity Assessment

TechniqueMethodologyExpected ResultsInterpretation
SDS-PAGE- 12% polyacrylamide gel
- Load 5-10 μg protein
- Coomassie or silver stain
- Single band at ~33-34 kDa (monomer)
- >90% purity
- Multiple bands may indicate degradation
- Higher MW bands suggest incomplete denaturation of oligomers
Western Blot- Anti-His antibody (1:3000)
- Secondary HRP-conjugated antibody (1:5000)
- Specific band at 33-34 kDa
- Minimal cross-reactivity
- Confirms identity of target protein
- Multiple bands may indicate degradation or proteolysis
Mass Spectrometry- Tryptic digest
- LC-MS/MS analysis
- >80% sequence coverage
- Correct MW (36.6 kDa with His-tag)
- Verifies primary sequence
- Identifies potential PTMs or modifications

Secondary Structure Analysis

TechniqueMethodologyExpected ResultsInterpretation
Circular Dichroism (CD)- 190-260 nm scan
- 0.1-0.2 mg/ml protein
- 1 mm path length
- α-helical pattern (negative peaks at 208 and 222 nm)
- ~60% α-helix, ~15% β-strand
- Proper folding indicated by expected secondary structure content
- Denatured protein shows random coil spectrum
FTIR Spectroscopy- ATR-FTIR
- 1-2 mg/ml protein
- Amide I band analysis
- Strong α-helical component (1650-1655 cm⁻¹)
- Transmembrane helices signature
- Complementary to CD for membrane proteins
- Less affected by buffer components
Intrinsic Fluorescence- Excitation: 280 nm
- Emission scan: 300-400 nm
- 0.1 mg/ml protein
- Emission maximum at ~335 nm (folded)
- Red shift to ~355 nm when denatured
- Blue-shifted emission indicates buried Trp residues in folded state
- Useful for monitoring thermal/chemical denaturation

Oligomeric State Verification

TechniqueMethodologyExpected ResultsInterpretation
Size Exclusion Chromatography- Superdex 200 column
- Flow rate: 0.5 ml/min
- Buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% DDM
- Major peak at ~250-300 kDa (pentamer + detergent)
- Minimal aggregation peak
- Single symmetric peak indicates homogeneous pentamer
- Multiple peaks suggest partial assembly or aggregation
Blue Native PAGE- 4-16% gradient gel
- Load 5-10 μg protein
- Coomassie G-250 as charge carrier
- Single band at ~180-200 kDa (pentamer)- Multiple bands indicate heterogeneous oligomeric states
- Lower MW bands suggest dissociation
Analytical Ultracentrifugation- Sedimentation velocity
- 0.5-1 mg/ml protein
- 40,000 rpm, 20°C
- Major species at ~9-10S (pentamer)
- >80% of total protein in pentameric form
- Most definitive analysis of homogeneity and stoichiometry
- Can detect minor species present at >5%

Thermal and Chemical Stability Assessment

TechniqueMethodologyExpected ResultsInterpretation
Thermal Shift Assay- SYPRO Orange dye
- Temperature gradient: 25-95°C
- 1°C/min ramp
- Tm ~50-55°C for detergent-solubilized ZntB
- Increased Tm (5-10°C) with Zn²⁺ present
- Higher Tm indicates increased stability
- Multiple transitions suggest domain unfolding
Chemical Denaturation- Guanidine HCl: 0-6M
- Monitor by intrinsic fluorescence
- 2 hour equilibration per point
- Mid-point of unfolding at ~2.5-3M GuHCl
- Two-state transition for well-folded protein
- Cooperative unfolding indicates proper tertiary structure
- Non-cooperative transitions suggest partially folded intermediates
Dynamic Light Scattering- 0.5-1 mg/ml protein
- Temperature scan: 25-70°C
- Measure at 2°C intervals
- Monodisperse population (PDI < 0.2) at 25°C
- Hydrodynamic radius ~5-6 nm for pentamer
- Increased radius and PDI at higher temperatures indicate unfolding/aggregation
- Temperature at which radius increases sharply corresponds to Tm

Functional Activity Assays

TechniqueMethodologyExpected ResultsInterpretation
Zinc Binding Assay- Isothermal Titration Calorimetry
- 20-50 μM ZntB
- 0.5-1 mM ZnSO₄ titrant
- KD in 1-10 μM range
- Exothermic binding
- Stoichiometry: ~1 Zn²⁺ per monomer
- Affinity should match physiological relevance
- Stoichiometry confirms binding site integrity
Fluorescence-based Transport- ZntB reconstituted in liposomes
- FluoZin-3 entrapped inside
- Add external Zn²⁺ (10-100 μM)
- Fluorescence increase upon zinc transport
- Transport rate: 5-15 nmol/min/mg protein
- Inhibition by 100 μM EDTA
- Demonstrates functional transport activity
- Control liposomes should show minimal transport
Proteoliposome Counterflow- ZntB-proteoliposomes loaded with 1 mM Zn²⁺
- External buffer with 10 μM Zn²⁺
- Sample at intervals for ICP-MS analysis
- Time-dependent efflux of zinc
- Saturation kinetics with Vmax ~10-15 nmol/min/mg
- Confirms bidirectional transport capability
- Kinetic parameters should match literature values
Complementation Assay- E. coli ΔzntB strain
- Express Salmonella ZntB
- Challenge with 0.5-1 mM ZnSO₄
- Restored growth in high zinc
- 3-5 fold increase in survival rate compared to control
- Biological validation of transport function
- Most relevant test for physiological activity

Structural Integrity Verification

TechniqueMethodologyExpected ResultsInterpretation
Limited Proteolysis- Trypsin digestion (1:100 ratio)
- Time points: 0, 5, 15, 30, 60 min
- Analyze by SDS-PAGE
- Properly folded: resistant core fragments
- Denatured: rapid complete digestion
- Pattern of proteolytic fragments indicates domain structure
- Resistance to proteolysis suggests compact folding
Hydrogen-Deuterium Exchange- D₂O exchange at pH 7.0
- Quench at intervals
- MS analysis of peptide fragments
- Transmembrane regions: slow exchange
- Surface loops: rapid exchange
- Maps solvent accessibility of different regions
- Confirms predicted topology of membrane insertion
Negative Stain EM- 0.01-0.05 mg/ml protein
- Uranyl acetate stain
- 30,000-50,000× magnification
- Pentameric particles ~10 nm diameter
- Homogeneous population
- Visual confirmation of oligomeric state
- Assesses sample homogeneity and aggregation

Comprehensive Validation Protocol

A recommended validation workflow for recombinant ZntB:

  • Initial Quality Check:

    • SDS-PAGE and Western blot for identity/purity

    • SEC for oligomeric state assessment

  • Structural Validation:

    • CD spectroscopy for secondary structure

    • Thermal stability assay for folding assessment

    • Limited proteolysis for domain integrity

  • Functional Validation:

    • Zinc binding assay (ITC or fluorescence quenching)

    • Proteoliposome transport assay

    • Complementation assay in ΔzntB bacteria

Using this systematic approach ensures that purified recombinant ZntB maintains its native pentameric structure and zinc transport functionality, providing confidence in subsequent experimental applications ranging from structural studies to functional characterization and drug screening .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.