Recombinant Salmonella paratyphi C 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Biological Role and Enzymatic Function

4-hydroxybenzoate octaprenyltransferase (UbiA) catalyzes the transfer of an octaprenyl group to 4-hydroxybenzoate (4-HB), forming 3-octaprenyl-4-hydroxybenzoate—a key intermediate in ubiquinone (coenzyme Q) biosynthesis . This reaction occurs within bacterial cell membranes and requires magnesium ions for activity .

Key enzymatic characteristics:

  • Substrate specificity: Prefers aromatic acceptors like 4-HB and polyprenyl diphosphates (e.g., octaprenyl diphosphate) .

  • Reaction mechanism: Cleaves the diphosphate group from the prenyl donor, forming a carbocation intermediate that reacts regiospecifically at the meta-position of 4-HB .

Applications in Research

  1. Vaccine Development: Recombinant UbiA serves as an antigen candidate for salmonellosis vaccines due to its surface exposure and role in virulence .

  2. Enzyme Kinetics: Used to study prenyltransferase mechanisms, including substrate promiscuity and inhibitor screening .

  3. Diagnostics: Employed in ELISA kits to detect Salmonella infections (e.g., Aviva Systems Bio OPCA171971) .

Stability and Handling Protocols

  • Storage: Lyophilized forms remain stable for 12 months at -80°C; liquid forms last 6 months with 50% glycerol .

  • Reconstitution: Requires centrifugation before resuspension to prevent aggregation .

  • Caution: Repeated freeze-thaw cycles degrade activity; working aliquots should be stored at 4°C for ≤1 week .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ubiA; SPC_4295; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
ubiA
Target Protein Sequence
MEWSLTQSKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGMPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVLTLNAMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGLGGGYY WAVLVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) using an all-trans polyprenyl group. It mediates the second step in ubiquinone-8 (UQ-8) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links

KEGG: sei:SPC_4295

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UbiA and what is its role in Salmonella metabolism?

UbiA (4-hydroxybenzoate octaprenyltransferase) is a membrane-bound enzyme that catalyzes a critical step in ubiquinone biosynthesis in Salmonella species. It specifically catalyzes the conversion of 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate by transferring the octaprenyl side chain. This reaction represents one of the initial steps in the ubiquinone biosynthetic pathway, which is essential for bacterial respiration and energy production. Ubiquinone (coenzyme Q) functions as an electron carrier in the respiratory chain, making UbiA indirectly essential for Salmonella survival and pathogenesis. Genetic studies have demonstrated that mutations in the ubiA gene result in ubiquinone-deficient bacterial strains that exhibit compromised growth and virulence capabilities .

How is the ubiA gene organized in Salmonella species?

The ubiA gene in Salmonella paratyphi encodes the 4-hydroxybenzoate octaprenyltransferase enzyme, which consists of 290 amino acids in its full-length form. Genetic mapping studies in related enterobacteria have positioned the ubiA gene at approximately minute 79 on the chromosome map. The gene product has several synonyms including "4-HB polyprenyltransferase," all referring to the same functional enzyme . The amino acid sequence includes multiple transmembrane domains consistent with its membrane-associated function, and the protein contains specific motifs required for substrate binding and catalytic activity. Sequence analysis reveals high conservation of this gene among Salmonella serovars, suggesting its fundamental importance in bacterial metabolism across species.

What expression systems are commonly used for recombinant UbiA production?

E. coli expression systems are the most commonly employed platforms for recombinant UbiA production from Salmonella paratyphi. Commercial preparations typically utilize E. coli strains optimized for membrane protein expression, with the UbiA protein expressed as a fusion construct containing affinity tags (most commonly His-tags) to facilitate purification . The expression construct generally includes the full-length UbiA sequence (amino acids 1-290) under the control of inducible promoters to allow controlled protein production. When expressing membrane proteins like UbiA, researchers must carefully optimize growth conditions, induction parameters, and extraction methods to maintain protein folding and functionality. Alternative expression systems including cell-free approaches may be employed for particularly challenging constructs, though these remain less common than traditional E. coli-based systems.

What are the basic storage and handling requirements for recombinant UbiA?

Recombinant UbiA protein preparations require specific storage and handling conditions to maintain stability and enzymatic activity. Purified UbiA is typically supplied as a lyophilized powder that should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add glycerol (5-50% final concentration, with 50% being standard practice) and store aliquots at -20°C or preferably -80°C to prevent protein degradation. Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided; working aliquots can be maintained at 4°C for up to one week . The reconstitution buffer typically consists of a Tris/PBS-based system at pH 8.0 with 6% trehalose as a stabilizing agent. When handling the protein, centrifugation prior to opening is advised to ensure all material is collected at the bottom of the storage container.

What experimental approaches can determine UbiA enzyme kinetics and substrate specificity?

Determining the enzyme kinetics and substrate specificity of UbiA requires specialized biochemical approaches due to its membrane-bound nature. The most effective experimental design involves:

  • Membrane fraction preparation: Isolate membrane fractions from cells expressing recombinant UbiA using ultracentrifugation following gentle cell lysis.

  • Enzyme assay setup: Develop an assay system containing the purified enzyme, 4-hydroxybenzoate substrate, octaprenyl diphosphate (or variants for specificity testing), and Mg²⁺ cofactor in appropriate buffer conditions .

  • Activity measurement: Monitor reaction progress using:

    • HPLC separation and quantification of reaction products

    • Radiometric assays with ¹⁴C-labeled substrates

    • Coupled enzyme assays measuring pyrophosphate release

  • Kinetic analysis: Determine key parameters by varying substrate concentrations:

ParameterTypical MethodExpected RangeInfluencing Factors
K<sub>m</sub> for 4-hydroxybenzoateLineweaver-Burk plot1-50 μMpH, temperature, membrane composition
K<sub>m</sub> for prenyl donorLineweaver-Burk plot0.5-10 μMChain length preference, isoprenoid type
V<sub>max</sub>Direct plot analysisVaries by preparationEnzyme concentration, purity, membrane environment
Cofactor requirementsActivity with/without Mg²⁺Optimal at 2-10 mM Mg²⁺Divalent cation specificity
  • Substrate specificity analysis: Test activity with alternative substrates including different benzoate derivatives and prenyl donors of varying chain lengths to establish specificity profiles.

The membrane-bound nature of UbiA presents technical challenges requiring detergent optimization to maintain native-like membrane environments while enabling substrate accessibility .

How can researchers effectively compare UbiA function across different Salmonella serovars?

Effective comparison of UbiA function across Salmonella serovars requires a multi-faceted approach combining genetic, biochemical, and computational methods:

  • Sequence alignment and phylogenetic analysis: Compare UbiA amino acid sequences from multiple serovars (including paratyphi A, paratyphi C, Typhi, and others) to identify conserved catalytic domains versus variable regions. Construct phylogenetic trees to visualize evolutionary relationships.

  • Heterologous complementation: Test functional equivalence by expressing UbiA variants from different serovars in a ΔubiA mutant background and assessing restoration of ubiquinone synthesis and respiratory competence .

  • Recombinant protein characterization:

    • Express and purify UbiA from multiple serovars under identical conditions

    • Determine enzyme kinetics for each variant using standardized assay conditions

    • Compare temperature and pH optima, substrate preferences, and inhibition profiles

  • Structural biology approaches:

    • Generate homology models based on available structural data

    • Identify potential differences in substrate binding pockets or active sites

    • Validate through site-directed mutagenesis of predicted key residues

  • In vivo significance assessment:

    • Create chimeric UbiA variants with domains swapped between serovars

    • Assess impact on ubiquinone production, bacterial fitness, and virulence

  • Data integration: Synthesize findings to determine whether functional differences correlate with host specificity, virulence potential, or metabolic capabilities of different Salmonella serovars.

This comparative approach provides insights into both the evolutionary conservation of UbiA function and potential adaptation of the enzyme to specific metabolic needs across Salmonella serovars.

What are the challenges in expressing and purifying membrane-bound UbiA protein?

Expressing and purifying membrane-bound UbiA presents several significant challenges that require specialized approaches:

  • Expression system limitations:

    • Membrane protein overexpression often leads to toxicity and inclusion body formation

    • Limited membrane space in host cells restricts proper insertion of recombinant proteins

    • Potential misfolding due to differences in membrane composition between native and expression hosts

  • Extraction and solubilization barriers:

    • Identifying optimal detergents that maintain protein structure and function

    • Balancing solubilization efficiency with retention of native conformation

    • Preventing aggregation during extraction from membrane environment

  • Purification complications:

    • Detergent micelles can interfere with affinity chromatography

    • Co-purification of host membrane proteins and lipids

    • Protein instability outside native membrane environment

  • Activity preservation strategies:

    • Reconstitution into liposomes or nanodiscs to restore native-like environment

    • Detergent screening to identify conditions that maintain enzymatic activity

    • Addition of stabilizing agents such as glycerol or specific lipids

  • Practical recommendations:

    • Utilize specialized E. coli strains (C41, C43) designed for membrane protein expression

    • Employ fusion partners that enhance membrane targeting and stability

    • Optimize induction conditions (lower temperature, reduced inducer concentration)

    • Consider cell-free expression systems with supplied membrane mimetics

The purification protocol must be carefully optimized with emphasis on maintaining the correct buffer conditions (typically Tris/PBS-based at pH 8.0), including stabilizing agents like trehalose, and minimizing exposure to conditions that promote protein aggregation .

How can researchers assess the impact of UbiA mutations on Salmonella pathogenicity?

Assessing the impact of UbiA mutations on Salmonella pathogenicity requires a comprehensive approach combining molecular genetics, biochemical characterization, and infection models:

  • Generation of defined ubiA mutants:

    • Create precise point mutations or deletions using CRISPR-Cas9 or allelic exchange methods

    • Develop complemented strains expressing wild-type or mutant UbiA variants

    • Construct fluorescently labeled strains for tracking during infection studies

  • In vitro phenotypic characterization:

    • Measure growth kinetics under aerobic, microaerobic, and anaerobic conditions

    • Quantify ubiquinone levels using HPLC or mass spectrometry

    • Assess membrane potential and respiratory capacity

    • Test sensitivity to oxidative stress and antimicrobial compounds

  • Cellular infection models:

    • Evaluate invasion and intracellular survival in macrophages and epithelial cells

    • Measure inflammatory responses (cytokine production) triggered by mutants

    • Assess intracellular replication rates compared to wild-type strains

  • In vivo infection studies:

    • Utilize appropriate animal models based on serovar host specificity

    • Measure bacterial burden in tissues following infection

    • Assess competitive index when co-infecting with wild-type bacteria

    • Monitor disease progression and host survival rates

  • Mechanistic investigations:

    • Determine whether attenuated virulence results from:

      • Reduced energy production affecting secretion system function

      • Altered membrane properties affecting host cell interactions

      • Increased susceptibility to host defense mechanisms

      • Metabolic deficiencies in specific host niches

By systematically analyzing these parameters, researchers can establish direct links between UbiA function, ubiquinone biosynthesis, and pathogenicity, potentially identifying new therapeutic targets in the ubiquinone pathway .

What protocols are recommended for optimal recombinant UbiA expression and purification?

The following optimized protocol provides a comprehensive approach for successful recombinant UbiA expression and purification:

Expression Protocol:

  • Transform expression plasmid containing the full-length UbiA sequence (amino acids 1-290) with N-terminal His-tag into E. coli C41(DE3) or Lemo21(DE3) strains specially designed for membrane protein expression .

  • Culture conditions:

    • Primary culture: Inoculate single colony in LB medium with appropriate antibiotic, grow overnight at 37°C

    • Secondary culture: Dilute 1:100 in Terrific Broth supplemented with 0.5% glucose

    • Grow at 37°C until OD₆₀₀ reaches 0.6-0.8

    • Reduce temperature to 18°C before induction

    • Induce with 0.1-0.4 mM IPTG (optimization required)

    • Continue expression for 16-20 hours at 18°C

  • Harvest cells by centrifugation (6,000 × g, 10 minutes, 4°C) and resuspend in lysis buffer containing:

    • 50 mM Tris-HCl, pH 8.0

    • 300 mM NaCl

    • 10% glycerol

    • 1 mM PMSF

    • Protease inhibitor cocktail

Purification Protocol:

  • Cell disruption:

    • Sonication (6 cycles of 30 seconds on/off) or high-pressure homogenization

    • Remove debris by centrifugation (10,000 × g, 20 minutes, 4°C)

    • Ultracentrifuge supernatant (100,000 × g, 1 hour, 4°C) to collect membrane fraction

  • Membrane solubilization:

    • Resuspend membrane pellet in solubilization buffer containing:

      • 50 mM Tris-HCl, pH 8.0

      • 300 mM NaCl

      • 10% glycerol

      • 1% n-dodecyl-β-D-maltoside (DDM) or 1.5% n-decyl-β-D-maltoside (DM)

    • Stir gently for 2 hours at 4°C

    • Ultracentrifuge (100,000 × g, 30 minutes, 4°C) to remove insoluble material

  • Affinity purification:

    • Apply solubilized material to Ni-NTA resin equilibrated with binding buffer

    • Wash extensively with buffer containing 20-40 mM imidazole and 0.05% DDM

    • Elute with buffer containing 250-300 mM imidazole and 0.05% DDM

  • Final processing:

    • Pool purified fractions and concentrate using 50 kDa MWCO concentrators

    • Apply to size exclusion chromatography column for final purification

    • Assess purity by SDS-PAGE (>90% required for functional studies)

    • Store in buffer containing 6% trehalose at -80°C for long-term storage

For activity studies, consider reconstitution into proteoliposomes using E. coli lipid extract to provide a native-like membrane environment for optimal enzyme function.

How can researchers develop reliable activity assays for UbiA enzymes?

Developing reliable activity assays for UbiA enzymes requires careful consideration of the membrane-bound nature of the protein and its specific reaction requirements. The following methodological approach outlines key steps for establishing robust UbiA activity assays:

1. Assay Design Considerations:

  • Buffer composition: 50-100 mM Tris-HCl or HEPES (pH 7.5-8.0)

  • Cofactor requirement: 5-10 mM MgCl₂ (essential for optimal activity)

  • Detergent selection: 0.03-0.05% DDM or 0.5% Triton X-100 (critical for enzyme stability)

  • Temperature: 30-37°C (temperature optimization recommended)

2. Substrate Preparation:

  • 4-Hydroxybenzoate: Prepare fresh stock solutions in assay buffer

  • Prenyl donor: All-trans-octaprenyl diphosphate (solubilized in minimal detergent)

  • Consider radioisotope labeling of either substrate for sensitive detection

3. Reaction Setup:

  • Typical reaction mixture (100 μL):

    • 1-5 μg purified UbiA or 50-100 μg membrane preparation

    • 50-200 μM 4-hydroxybenzoate

    • 10-50 μM octaprenyl diphosphate

    • 5-10 mM MgCl₂

    • Assay buffer with appropriate detergent

4. Detection Methods:
a) HPLC-based detection:
- Extract reaction products with ethyl acetate or chloroform/methanol
- Analyze using reverse-phase HPLC with UV detection at 254 nm
- Confirm identity using mass spectrometry if available

b) Radiometric assay:
- Use ¹⁴C-labeled 4-hydroxybenzoate as substrate
- Extract product and quantify radioactivity by liquid scintillation counting
- Calculate conversion rates based on specific activity

c) Coupled enzyme assay:
- Monitor pyrophosphate release using coupled enzymatic reactions
- Measure inorganic phosphate formation colorimetrically

5. Controls and Validation:

  • Negative controls: Heat-inactivated enzyme, reaction without magnesium, reaction without one substrate

  • Positive controls: Known active UbiA preparation with established activity

  • Linearity verification: Ensure reaction rates are linear with respect to time and enzyme concentration

6. Data Analysis:

  • Calculate specific activity in nmol product formed/min/mg protein

  • For kinetic studies, use multiple substrate concentrations to determine Km and Vmax

  • Prepare Lineweaver-Burk or Eadie-Hofstee plots for kinetic parameter determination

7. Troubleshooting Guide:

  • Low activity: Check enzyme stability, increase detergent or lipid content

  • High background: Improve extraction procedure, optimize HPLC separation

  • Variable results: Standardize membrane preparation or purification procedure

What approaches are effective for studying UbiA structure-function relationships?

Investigating UbiA structure-function relationships requires an integrated approach combining computational, molecular, and biochemical techniques. The following methodological framework provides effective strategies for such studies:

1. Computational Analysis and Prediction:

  • Homology modeling using related prenyltransferase structures as templates

  • Molecular docking simulations with 4-hydroxybenzoate and prenyl substrates

  • Molecular dynamics simulations to identify dynamic binding regions

  • Identification of conserved motifs through multiple sequence alignment across bacterial species

2. Site-Directed Mutagenesis Strategy:

  • Target conserved residues in predicted:

    • Substrate binding sites

    • Catalytic centers

    • Membrane-spanning regions

    • Divalent cation coordination sites

  • Create systematic alanine scanning libraries of transmembrane domains

  • Design rational mutations based on computational predictions

3. Functional Characterization of Mutants:

  • Express and purify mutant proteins using the optimized protocol

  • Conduct comprehensive kinetic analysis:

Mutation TypeParameter to AssessExpected OutcomeInterpretation
Active site residuesk<sub>cat</sub>, K<sub>m</sub>Reduced k<sub>cat</sub>, altered K<sub>m</sub>Direct role in catalysis
Substrate bindingK<sub>m</sub> for specific substratesIncreased K<sub>m</sub>Role in substrate recognition
Membrane anchoringMembrane associationAltered membrane localizationImportance for proper insertion
Mg²⁺ coordinationActivity dependence on Mg²⁺Altered Mg²⁺ requirementCofactor binding site

4. Protein-Substrate Interaction Studies:

  • Photo-affinity labeling with substrate analogs

  • Differential scanning fluorimetry to assess thermal stability with/without substrates

  • Isothermal titration calorimetry for binding thermodynamics

  • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes

5. In Vivo Complementation:

  • Introduce mutant UbiA variants into ΔubiA strains

  • Assess restoration of:

    • Ubiquinone synthesis (HPLC quantification)

    • Respiratory growth capacity

    • Resistance to oxidative stress

6. Advanced Structural Studies:

  • X-ray crystallography attempts (challenging for membrane proteins)

  • Cryo-electron microscopy for structural determination

  • NMR studies on purified protein in detergent micelles or nanodiscs

7. Integration and Mapping:

  • Correlate functional data with structural predictions

  • Map critical residues onto structural models

  • Develop a mechanistic model for the prenylation reaction

  • Compare with related prenyltransferases to identify unique features

This systematic approach allows researchers to establish structure-function relationships that can inform both fundamental understanding of enzyme mechanism and potential applications in enzyme engineering or inhibitor design .

How can researchers overcome protein stability issues when working with recombinant UbiA?

Recombinant UbiA stability presents significant challenges due to its membrane-bound nature. The following systematic approach addresses these challenges with practical solutions:

Problem 1: Protein aggregation during purification

  • Solution strategies:

    • Optimize detergent type and concentration through systematic screening

    • Include stabilizing agents: 10-15% glycerol, 6% trehalose, or 100-200 mM sucrose

    • Maintain strict temperature control (4°C throughout purification)

    • Add reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) if disulfide formation is suspected

    • Use amphipols or peptidisc technology as detergent alternatives

Problem 2: Activity loss during storage

  • Solution strategies:

    • Lyophilize protein in presence of stabilizing agents (preferred for long-term storage)

    • Store at -80°C in small single-use aliquots to prevent freeze-thaw cycles

    • Add protease inhibitor cocktail to storage buffer

    • Consider addition of specific lipids that enhance stability (E. coli lipid extract at 0.1-0.5 mg/mL)

    • When working with the protein, keep on ice and use within 4-8 hours of thawing

Problem 3: Poor expression yields

  • Solution strategies:

    • Optimize codon usage for expression host

    • Reduce expression temperature to 18-20°C

    • Test different fusion partners: MBP, SUMO, or Mistic (specific for membrane proteins)

    • Screen expression strains specifically designed for membrane proteins

    • Consider cell-free expression systems with supplied lipids or nanodiscs

Problem 4: Reconstitution challenges

  • Solution strategies:

    • Develop optimized proteoliposome preparation protocol:

      • Use gradual detergent removal via dialysis or adsorbent beads

      • Test different lipid compositions and protein:lipid ratios

      • Monitor incorporation efficiency using sucrose gradient ultracentrifugation

    • Alternative membrane mimetics:

      • Nanodiscs with MSP1D1 scaffold protein

      • Styrene-maleic acid lipid particles (SMALPs)

      • Synthetic polymer-based systems (amphipols)

Problem 5: Analytical challenges

  • Solution strategies:

    • Implement specialized techniques for membrane protein quality assessment:

      • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS)

      • Analytical ultracentrifugation for oligomeric state determination

      • Circular dichroism to verify secondary structure integrity

      • Fluorescence-based thermal shift assays adapted for membrane proteins

Implementation of these methodological solutions significantly enhances UbiA stability throughout the research workflow, from expression through purification, storage, and functional characterization .

What are common pitfalls in interpreting UbiA enzyme activity data and how can they be avoided?

Pitfall 1: Inadequate controls leading to false positive/negative results

  • Solution approach:

    • Implement comprehensive control matrix:

      • Positive control: Validated active UbiA preparation

      • Negative controls: Heat-inactivated enzyme, reaction without magnesium , omission of individual substrates

      • Background controls: Complete reaction mixture without enzyme to account for non-enzymatic reactions

    • Validation strategy: Compare activity patterns across multiple independent preparations to establish reproducibility benchmarks

Pitfall 2: Misattribution of activity due to contaminating enzymes

  • Solution approach:

    • Enhanced purification validation:

      • Verify purity >90% by SDS-PAGE and mass spectrometry

      • Test activity correlation with UbiA concentration (should be linear)

      • Perform inhibition studies with specific UbiA inhibitors

      • Express and test catalytically inactive UbiA mutants as negative controls

    • Activity verification: Compare wild-type activity with site-directed mutants affecting known catalytic residues

Pitfall 3: Misinterpretation of kinetic parameters due to detergent effects

  • Solution approach:

    • Detergent standardization:

      • Systematically test multiple detergent types and concentrations

      • Document detergent effects on apparent Km and Vmax values

      • Consider micelle concentration and substrate partitioning effects

    • Data normalization: Report kinetic parameters under standardized detergent conditions with appropriate corrections for substrate partitioning

Pitfall 4: Substrate limitation or product inhibition artifacts

  • Solution approach:

    • Reaction optimization:

      • Establish appropriate substrate concentration ranges (typically 10× Km)

      • Monitor reaction linearity with respect to time

      • Implement progress curve analysis for detecting product inhibition

    • Product removal strategies: Consider coupled enzyme systems that remove pyrophosphate to prevent feedback inhibition

Pitfall 5: Overlooking the membrane environment's influence

  • Solution approach:

    • Membrane reconstitution comparison:

      • Compare activity in detergent micelles vs. reconstituted proteoliposomes

      • Systematically vary lipid composition to determine optimal conditions

      • Quantify protein orientation in reconstituted systems

    • Environmental sensitivity analysis: Test activity across pH, ionic strength, and temperature ranges in different membrane mimetics

Pitfall 6: Inappropriate data analysis methods

  • Solution approach:

    • Statistical rigor:

      • Perform minimum of three independent replicates for all activity measurements

      • Apply appropriate statistical tests with confidence intervals

      • Use non-linear regression rather than linearized plots for kinetic parameter determination

    • Transparent reporting: Include raw data, analysis methods, and explicit description of reaction conditions in publications

By systematically addressing these pitfalls, researchers can generate more reliable and reproducible data on UbiA enzyme activity, facilitating accurate interpretation of structure-function relationships and comparative studies across different Salmonella serovars .

What emerging technologies could advance UbiA research in Salmonella species?

Several cutting-edge technologies are poised to revolutionize UbiA research in Salmonella species, enabling deeper insights into structure, function, and physiological relevance:

1. Structural Biology Innovations:

  • Cryo-electron microscopy advances:

    • Single-particle analysis for membrane protein structure determination

    • Time-resolved cryo-EM to capture catalytic intermediates

    • In situ structural studies within native membranes

  • Integrated structural approaches:

    • Micro-electron diffraction (microED) for small crystal analysis

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Solid-state NMR techniques optimized for membrane proteins

2. Genetic Engineering Tools:

  • CRISPR-Cas systems:

    • Base editors for precise point mutations without selection markers

    • Prime editing for specific nucleotide substitutions in chromosomal ubiA

    • CRISPRi/CRISPRa for tunable gene expression modulation

  • Synthetic biology platforms:

    • Minimal synthetic chassis for reconstituting ubiquinone biosynthesis

    • Orthogonal translation systems for unnatural amino acid incorporation

    • Biosensors for real-time ubiquinone production monitoring

3. Advanced Analytical Methods:

  • Metabolomics integration:

    • Targeted LC-MS/MS for comprehensive ubiquinone pathway profiling

    • Flux analysis using stable isotope labeling

    • Single-cell metabolomics to assess heterogeneity in bacterial populations

  • Imaging technologies:

    • Super-resolution microscopy for subcellular localization

    • FRET-based sensors for enzyme-substrate interactions

    • Label-free Raman microscopy for in vivo detection of ubiquinone

4. Computational Approaches:

  • Machine learning applications:

    • Prediction of structure-function relationships from sequence data

    • Virtual screening for novel inhibitors targeting UbiA

    • Automated design of UbiA variants with enhanced properties

  • Molecular simulation advancements:

    • Enhanced sampling methods for membrane protein dynamics

    • Quantum mechanics/molecular mechanics (QM/MM) for reaction mechanism elucidation

    • Coarse-grained simulations of UbiA in complex membrane environments

5. Translational Research Tools:

  • High-throughput screening platforms:

    • Microfluidic systems for enzyme variant analysis

    • Cell-based assays for inhibitor discovery

    • Whole-animal imaging for tracking Salmonella with modified UbiA function

  • Nanobody and aptamer development:

    • Conformation-specific binders for structure stabilization

    • Activity modulators for mechanistic studies

    • In vivo imaging tools for infection studies

The integration of these emerging technologies will accelerate fundamental understanding of UbiA function in Salmonella species while potentially revealing new therapeutic opportunities targeting the ubiquinone biosynthetic pathway.

How might comparative genomics inform our understanding of UbiA evolution in Salmonella?

Comparative genomics offers powerful approaches to illuminate UbiA evolution across Salmonella species, providing insights into adaptation, conservation, and potential functional specialization. The following methodological framework outlines key strategies for leveraging genomic data:

1. Phylogenetic Analysis Approaches:

  • Comprehensive sequence sampling:

    • Collect ubiA sequences from diverse Salmonella serovars

    • Include sequences from related Enterobacteriaceae and distant bacterial phyla

    • Create phylogenetic trees using maximum likelihood and Bayesian methods

  • Evolutionary rate analysis:

    • Calculate dN/dS ratios to identify selection pressures

    • Test for lineage-specific rate variations

    • Identify potential recombination events affecting ubiA evolution

2. Sequence-Structure-Function Correlations:

  • Conservation mapping:

    • Align sequences from multiple Salmonella serovars

    • Map conservation patterns onto structural models

    • Identify hypervariable regions versus invariant catalytic domains

  • Host adaptation signatures:

    • Compare UbiA sequences from host-restricted versus broad-host-range serovars

    • Identify potential adaptive mutations correlating with host specificity

    • Test functional consequences of serovar-specific variations

3. Genomic Context Analysis:

  • Operonic structure examination:

    • Compare genomic organization of ubiA and related genes

    • Identify potential co-transcribed genes and regulatory elements

    • Map operon evolution across Salmonella lineages

  • Horizontal gene transfer assessment:

    • Evaluate GC content and codon usage patterns

    • Search for mobile genetic element signatures

    • Reconstruct potential transfer events in Salmonella evolution

4. Experimental Validation Strategies:

  • Ancestral sequence reconstruction:

    • Computationally predict ancestral UbiA sequences

    • Express and characterize reconstructed proteins

    • Compare biochemical properties with extant enzymes

  • Domain swapping experiments:

    • Create chimeric proteins with domains from different serovars

    • Test functional consequences of domain exchanges

    • Identify regions responsible for specific adaptations

5. Integrative Bioinformatic Analysis:

  • Correlation with virulence determinants:

    • Identify patterns of co-evolution with virulence factors

    • Assess potential functional relationships through network analysis

    • Develop predictive models of UbiA contribution to pathogenicity

  • Metabolic network integration:

    • Model UbiA within the context of Salmonella metabolism

    • Predict metabolic consequences of UbiA variations

    • Identify potential metabolic adaptations linked to UbiA evolution

This comprehensive comparative genomics approach will reveal evolutionary trajectories of UbiA in Salmonella, potentially identifying adaptive signatures related to host specificity, virulence, and metabolic specialization that could inform both fundamental understanding and applied interventions.

What are the key considerations for researchers beginning work with UbiA in Salmonella species?

Researchers initiating studies on UbiA in Salmonella species should consider several critical factors to ensure successful outcomes. First, the membrane-bound nature of UbiA necessitates specialized techniques for expression, purification, and functional characterization that differ significantly from soluble protein methodologies . Careful selection of expression systems, typically E. coli strains optimized for membrane proteins, coupled with appropriate detergent selection for extraction and stabilization, is essential for obtaining functional protein. Storage conditions require particular attention, with recommendations including lyophilization with stabilizing agents and storage at -80°C to maintain activity .

Experimental design should incorporate the required cofactors, particularly Mg2+, which is essential for optimal enzymatic activity . Researchers must also consider the potential differences between Salmonella serovars, as variations in UbiA sequence and function may impact experimental outcomes. Comprehensive controls, including positive and negative controls for activity assays, are crucial for reliable data interpretation. Finally, integration of structural predictions with functional data provides the most complete understanding of this essential enzyme. By addressing these considerations systematically, researchers can establish robust experimental systems for investigating UbiA's role in ubiquinone biosynthesis and bacterial metabolism.

How can UbiA research contribute to broader understanding of bacterial metabolism and pathogenesis?

UbiA research contributes significantly to our understanding of bacterial metabolism and pathogenesis through multiple interconnected dimensions. As a critical enzyme in ubiquinone biosynthesis, UbiA sits at a crucial intersection of respiratory metabolism and membrane function. Detailed characterization of its structure-function relationships illuminates fundamental aspects of membrane protein enzymology, including substrate recognition, catalytic mechanisms, and membrane integration strategies that have broad implications beyond Salmonella species.

From a metabolic perspective, understanding UbiA function provides insights into respiratory flexibility and adaptation to different environmental conditions that Salmonella encounters during infection. The ubiquinone biosynthetic pathway represents an essential metabolic process that potentially influences virulence through multiple mechanisms: by enabling efficient energy production needed for virulence factor expression, by contributing to membrane properties that affect host interactions, and by providing protection against oxidative stress encountered during host immune responses .

The essentiality of UbiA for Salmonella growth and survival positions it as a potential target for antimicrobial development. Structure-based inhibitor design targeting UbiA could lead to novel therapeutics with specificity for bacterial systems. Furthermore, comparative studies across bacterial species may reveal unique features of Salmonella UbiA that contribute to its specific pathogenic lifestyle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.