Recombinant Salmonella paratyphi C Bifunctional protein aas (aas)

What is Bifunctional protein Aas and what is its role in Salmonella species?

Bifunctional protein Aas (encoded by the aas gene) is a full-length protein found in various Salmonella serovars. In Salmonella paratyphi B, it consists of 719 amino acids with the sequence beginning with MLFGFFRNLFRVLYRVRVTGDVRALQGNRVLITPNHVSFIDGMLLALFLPVRPVFAVYTS and continuing through its full length . The "bifunctional" designation suggests dual enzymatic activities, likely related to bacterial metabolism and potential roles in pathogenesis. While specific Aas functions aren't directly addressed in the available research, its conservation across Salmonella strains suggests biological importance.

How does S. paratyphi relate to other pathogenic Salmonella strains?

S. paratyphi C is a human-adapted typhoid agent that causes systemic infection. Genomic analysis of S. paratyphi C strain RKS4594 reveals it does not share a common ancestor with other human-adapted typhoid agents like S. typhi . Instead, S. paratyphi C has diverged from a common ancestor with S. choleraesuis (primarily a swine pathogen). RKS4594 shares 4,346 genes with S. choleraesuis but only 4,008 genes with S. typhi . This supports a convergent evolution model where different typhoid agents acquired similar pathogenic traits independently rather than inheriting them from a common ancestor.

What structural characteristics define recombinant Salmonella Aas protein?

Based on data from S. paratyphi B, recombinant Aas protein consists of 719 amino acids and is typically expressed with an N-terminal His tag to facilitate purification . The protein's complete amino acid sequence has been characterized, and when properly expressed, it demonstrates >90% purity as determined by SDS-PAGE . While specific data for S. paratyphi C Aas isn't provided in the search results, we can infer similar structural properties with sequence variations reflecting evolutionary divergence between strains.

What expression systems are optimal for producing recombinant Aas protein?

E. coli expression systems have been successfully used to produce recombinant Aas protein . When designing expression constructs, researchers should:

• Include the full-length coding sequence (1-719 amino acids for S. paratyphi B)

• Add an N-terminal His tag for purification purposes

• Select expression vectors with appropriate promoters for controlled expression

• Optimize codon usage if necessary for efficient translation

• Consider induction conditions that maximize protein solubility

While working with expression systems, researchers should be aware that bacterial proteins may form inclusion bodies requiring specialized extraction and refolding protocols.

What storage and handling protocols maintain Aas protein stability?

The following storage and handling recommendations ensure optimal stability and activity of recombinant Aas protein:

Before opening, vials should be briefly centrifuged to bring contents to the bottom . For long-term storage, adding glycerol to a final concentration of 5-50% is recommended, with 50% being the default recommendation .

How can researchers validate recombinant Aas protein functionality?

To confirm that recombinant Aas protein maintains its native biological functions, researchers should implement these validation approaches:

• Biochemical characterization:

  • Enzymatic activity assays targeting predicted bifunctional activities

  • Binding assays with potential interaction partners

  • Circular dichroism to confirm proper secondary structure

• Functional complementation:

  • Generate aas gene knockout in Salmonella

  • Test whether recombinant protein can restore wild-type phenotypes

  • Compare effects of wild-type versus mutant versions of the protein

• Structural validation:

  • Confirm protein folding through biophysical techniques

  • Verify absence of aggregation through size-exclusion chromatography

  • Assess thermal stability through differential scanning fluorimetry

How can Aas protein be investigated in the context of Salmonella pathogenesis?

While specific roles of Aas in pathogenesis are not directly addressed in the search results, researchers can apply approaches used for other Salmonella proteins:

• Gene knockout studies: Create aas deletion mutants and evaluate:

  • Changes in bacterial growth under various conditions

  • Alterations in stress response, similar to studies on htrA

  • Effects on virulence in infection models

  • Changes in bacterial morphology or membrane integrity

• Transcriptional analysis:

  • Determine expression patterns of aas during different growth phases

  • Measure aas expression during host cell infection

  • Identify regulatory elements controlling aas expression

• Host interaction studies:

  • Assess whether Aas protein interacts with host cell components

  • Determine if Aas elicits immune responses during infection

  • Evaluate potential roles in immune evasion mechanisms

What approaches can reveal evolutionary insights about Aas protein across Salmonella strains?

Comparative genomic approaches can uncover important evolutionary insights:

• Sequence comparison analysis:

  • Align aas genes from multiple Salmonella serovars

  • Identify conserved domains indicating essential functions

  • Detect variable regions potentially involved in host adaptation

  • Calculate selection pressures (dN/dS ratios) to identify positively selected sites

• Structural prediction comparisons:

  • Generate structural models of Aas from different Salmonella strains

  • Compare predicted functional domains and active sites

  • Identify strain-specific structural features

• Evolutionary context analysis:

  • Examine flanking genes to identify potential operons

  • Determine if aas has undergone horizontal gene transfer

  • Assess whether aas is an intact gene or pseudogene in different lineages

Given that S. paratyphi C has undergone significant selection pressure during human adaptation, as evidenced by differential nucleotide substitutions and pseudogenes , analyzing how these evolutionary forces have shaped the aas gene could provide valuable insights into its function.

How might Aas protein contribute to immunogenic responses in vaccine development?

While specific immunogenic properties of Aas protein are not directly addressed in the search results, insights can be drawn from studies of other Salmonella proteins:

• Potential as vaccine candidate:

  • If Aas is an outer membrane or secreted protein, it may have immunogenic potential similar to other surface proteins

  • Recombinant Aas could be evaluated as a subunit vaccine component

  • Immunization studies could determine protective efficacy against challenge

• Comparative approaches:

  • Other Salmonella outer membrane proteins (LamB, PagC, TolC, NmpC, and FadL) have shown significant immunoprotection when used as vaccines

  • Surface proteins such as SpaO and H1a elicited protective immune responses with protection rates of 58.3-66.7% and 41.7-58.3% respectively

  • Combination approaches, similar to SpaO+H1a mixtures that achieved 83.3-91.7% protection, could be explored

What controls should be included in experimental designs involving recombinant Aas protein?

Robust experimental design requires appropriate controls:

• Negative controls:

  • Buffer-only conditions matching storage buffer composition

  • Irrelevant recombinant protein expressed and purified under identical conditions

  • Heat-inactivated Aas protein to control for non-specific effects

  • Empty vector controls in expression studies

• Positive controls:

  • Well-characterized proteins with similar biochemical properties

  • Native (non-recombinant) Aas protein if available

  • Positive control assays demonstrating system functionality

• Technical validation controls:

  • Western blot or mass spectrometry to confirm protein identity

  • Activity assays targeting predicted functions

  • Purity assessment through SDS-PAGE (>90% purity standard)

What technical challenges might researchers encounter when working with recombinant Aas protein?

Researchers should anticipate and plan for these potential challenges:

• Expression and purification issues:

  • Protein solubility problems requiring optimization of expression conditions

  • Potential toxicity to E. coli expression host

  • Contamination with bacterial endotoxins requiring additional purification steps

• Stability concerns:

  • Protein degradation during storage, especially with repeated freeze-thaw cycles

  • Loss of activity due to improper buffer conditions

  • Aggregation during concentration or reconstitution

• Functional considerations:

  • Potential interference of His-tag with protein function

  • Absence of post-translational modifications present in native protein

  • Effects of E. coli expression on protein folding compared to Salmonella expression

How can researchers approach structure-function analysis of Aas protein?

Structure-function analysis requires multifaceted approaches:

• Computational analysis:

  • Homology modeling based on related proteins with known structures

  • Identification of functional domains through sequence analysis

  • Prediction of active sites and binding interfaces

• Mutagenesis strategies:

  • Site-directed mutagenesis of predicted key residues

  • Creation of truncation mutants to identify essential domains

  • Domain swapping between Aas proteins from different Salmonella strains

• Biophysical characterization:

  • Circular dichroism to assess secondary structure content

  • Differential scanning calorimetry to measure thermal stability

  • X-ray crystallography or cryo-EM for high-resolution structural determination

How should researchers interpret variability in Aas protein functional assays?

When analyzing experimental data on Aas protein function:

• Sources of variability:

  • Batch-to-batch differences in protein preparation

  • Storage duration effects on protein activity

  • Influence of buffer components on functional assays

  • Technical variations in experimental equipment

• Statistical approaches:

  • Use appropriate statistical tests for comparative analyses

  • Include sufficient biological and technical replicates

  • Consider power analysis to determine adequate sample sizes

  • Report effect sizes along with statistical significance

• Validation strategies:

  • Confirm key findings using alternative methodological approaches

  • Verify results across different experimental conditions

  • Compare data with predictions from computational analyses

What approaches can resolve contradictory findings about Aas protein function?

Resolving contradictory results requires systematic investigation:

• Methodological reconciliation:

  • Compare experimental protocols, identifying key differences

  • Standardize methods across laboratories when possible

  • Evaluate effects of protein tags on functional outcomes

  • Consider strain-specific differences in Aas protein

• Contextual considerations:

  • Assess effects of experimental conditions (temperature, pH, ionic strength)

  • Evaluate impacts of bacterial growth phase on Aas function

  • Consider effects of host environment factors on protein activity

• Collaborative approaches:

  • Conduct inter-laboratory validation studies

  • Share reagents and protocols to ensure comparability

  • Develop consensus methods for Aas functional characterization

How can researchers effectively compare Aas protein from different Salmonella strains?

Comparative analysis across Salmonella strains requires:

• Standardized expression and purification:

  • Use identical expression systems and purification protocols

  • Ensure comparable protein purity (>90% standard)

  • Verify protein folding and activity through consistent assays

• Comprehensive characterization:

  • Compare sequence homology and identify strain-specific variations

  • Assess functional differences through identical assay conditions

  • Evaluate structural variations through biophysical techniques

• Evolutionary context integration:

  • Consider adaptation pressures in strain-specific hosts

  • Analyze gene neighborhood and regulatory elements across strains

  • Integrate findings with broader genomic comparison data, such as the relationship between S. paratyphi C and S. choleraesuis compared to S. typhi