Recombinant Salmonella paratyphi C Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Cobalamin Synthase (CobS) in Salmonella Paratyphi C

Cobalamin synthase (CobS) is a critical enzyme in the biosynthesis of adenosylcobalamin (vitamin B12), essential for microbial metabolism. In Salmonella Paratyphi C, a human-adapted pathogen causing enteric fever, CobS catalyzes the final steps of cobalamin assembly by linking adenosylcobinamide-GDP to α-ribazole-5′-phosphate . Recombinant CobS enables large-scale studies of cobalamin-dependent pathways and supports vaccine development against Salmonella infections .

Genetic and Molecular Characterization

The cobS gene in Salmonella Paratyphi C strain RKS4594 is located at locus SPC_1698 and encodes a 247-amino acid protein (UniProt ID: C0Q1Q9) . Key features include:

  • Molecular weight: ~28 kDa (calculated).

  • Domain structure: Predicted transmembrane helices and conserved motifs for nucleotide loop assembly .

  • Genomic context: Situated within a highly plastic genome region, flanked by mobile genetic elements .

Biochemical Function and Catalytic Mechanism

CobS functions as a cobalamin-5′-phosphate synthase, facilitating two critical reactions :

  1. Substrate binding: Adenosylcobinamide-GDP and α-ribazole-5′-phosphate are joined via a phosphodiester bond.

  2. Product formation: Generates adenosylcobalamin-5′-phosphate, later dephosphorylated to active cobalamin .

Key catalytic residues:

  • His-tag fusion (N-terminal) enhances solubility during recombinant expression .

  • Conserved arginine and serine residues critical for GTP binding and catalysis .

Recombinant Production and Purification

Recombinant CobS from Salmonella Paratyphi C is produced in E. coli systems for research and industrial applications :

ParameterDetails
Expression systemE. coli (BL21 or similar strains)
TagN-terminal His-tag for affinity chromatography
Purity>90% (verified by SDS-PAGE)
StorageTris buffer with 50% glycerol, stable at -80°C
ApplicationsEnzyme kinetics, structural studies, glycoconjugate vaccine development

Functional Insights from In Vitro Studies

  • CobS activity is ATP-independent but requires GTP as a cofactor .

  • The enzyme retains function with modified lower ligands (e.g., benzimidazole analogs), enabling synthetic cobalamin production .

Role in Pathogen Adaptation

  • Genomic degradation in Salmonella Paratyphi C has spared cobS, highlighting its metabolic necessity .

  • CobS-deficient strains show impaired growth under cobalamin-limiting conditions, suggesting a role in host colonization .

Vaccine Development

  • Recombinant CobS is used in glycoconjugate vaccines (e.g., COPS:FliC) to enhance immune responses against Salmonella surface polysaccharides .

Table 2: Comparison of CobS Across Salmonella Serovars

SerovarHost SpecificityCobS ActivityGenomic Stability
S. Paratyphi CHumanHighModerate
S. TyphimuriumBroadHighHigh
S. CholeraesuisSwineHighLow

Future Directions

Current research focuses on engineering thermostable CobS variants and exploring its role in microbial-host cobalamin competition. Structural studies (e.g., cryo-EM) are underway to resolve its membrane-associated conformation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; SPC_1698; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQSWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLTKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL
Uniprot No.

Target Background

Function
Catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: sei:SPC_1698

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (cobS) and what is its role in Salmonella species?

Cobalamin synthase (cobS) is a critical enzyme in the vitamin B12 biosynthetic pathway of Salmonella species. Specifically in Salmonella paratyphi C, cobS functions as the cobalamin(-5′-phosphate) synthase that catalyzes a key step in the nucleotide loop assembly pathway of adenosylcobalamin biosynthesis. The 247-amino acid protein plays an essential role in connecting adenosylcobinamide-GDP with α-ribazole-5′-phosphate to form adenosylcobalamin−5′-phosphate . This reaction represents a critical step in the formation of the complete cobalamin molecule.

What expression systems are optimal for producing recombinant Salmonella paratyphi C cobS?

Based on available research data, Escherichia coli serves as an effective expression system for Salmonella paratyphi C cobS . The protein can be successfully expressed with an N-terminal histidine tag to facilitate purification. This approach aligns with successful methods used for expressing S. typhimurium cobalamin biosynthetic genes in E. coli, which resulted in up to 100-fold increases in corrin production compared to the parent Salmonella strain .

For optimal expression, researchers should consider:

  • Using a strong, inducible promoter system compatible with E. coli

  • Codon optimization if expression yields are suboptimal

  • Expression with affinity tags (His-tag recommended) for streamlined purification

  • Growth conditions that minimize inclusion body formation

  • Anaerobic conditions if functional studies are planned, as cobalamin synthesis is only observed under anaerobic environments

What are the recommended storage and handling conditions for recombinant cobS protein?

For maintaining recombinant Salmonella paratyphi C cobS stability and activity, follow these evidence-based recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot the protein to prevent repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimal: 50%) for long-term storage

  • Store working aliquots at 4°C for up to one week

  • Avoid repeated freezing and thawing as this significantly degrades protein quality

How can I design an in vitro assay to measure cobS enzymatic activity?

Based on successful studies with S. typhimurium cobS, which shares high homology with S. paratyphi C cobS, an effective in vitro assay can be designed as follows:

  • Prepare reaction mixtures containing:

    • Adenosylcobinamide-GDP (substrate 1)

    • α-ribazole-5′-phosphate (substrate 2)

    • Purified recombinant cobS protein

    • Appropriate buffer system

  • Maintain anaerobic conditions throughout the assay, which is critical for activity

  • Detect adenosylcobalamin−5′-phosphate formation using:

    • HPLC separation

    • UV-visible spectroscopy (characteristic absorption spectrum)

    • Mass spectrometry confirmation

  • For complete pathway assessment, include:

    • Adenosylcobinamide

    • 5,6-dimethylbenzimidazole

    • Nicotinate mononucleotide

    • GTP

    • Purified CobU, CobT, and CobC proteins

The resulting adenosylcobalamin−5′-phosphate can be isolated by HPLC, identified by spectroscopic methods, and validated through functional assays using cobalamin auxotrophs .

What strategies can be employed to study the structure-function relationship of cobS?

To investigate structure-function relationships in Salmonella paratyphi C cobS, consider these advanced approaches:

  • Site-directed mutagenesis:

    • Target conserved residues across cobS homologs

    • Focus on amino acids predicted to participate in substrate binding or catalysis

    • Systematically analyze mutant activity profiles

  • Domain swapping experiments:

    • Exchange functional domains between cobS from different bacterial species

    • Assess activity of chimeric proteins to identify critical regions

  • Structural biology approaches:

    • X-ray crystallography with and without substrates/substrate analogs

    • Cryo-electron microscopy for structural determination

    • Homology modeling based on related proteins

  • Protein-substrate interaction studies:

    • Isothermal titration calorimetry to measure binding affinities

    • Surface plasmon resonance for kinetic binding analysis

    • NMR studies for dynamic interaction mapping

  • Computational approaches:

    • Molecular docking simulations

    • Molecular dynamics to understand conformational changes

    • QM/MM studies to elucidate the reaction mechanism

How can cobS function be studied in context with other cobalamin biosynthetic enzymes?

To understand cobS within the broader context of cobalamin biosynthesis:

  • Reconstitute the complete nucleotide loop assembly pathway in vitro:

    • Combine purified CobU, CobT, CobS, and CobC enzymes

    • Add all necessary substrates: adenosylcobinamide, 5,6-dimethylbenzimidazole, nicotinate mononucleotide, and GTP

    • Monitor formation of adenosylcobalamin as the end product

  • Design coupled enzyme assays:

    • Use the product of one enzyme reaction as substrate for the next

    • Establish rate-limiting steps in the pathway

    • Identify potential regulatory points

  • Investigate protein-protein interactions:

    • Co-immunoprecipitation studies

    • Bacterial two-hybrid systems

    • Pull-down assays with tagged proteins

  • Develop a heterologous expression system:

    • Express S. paratyphi C cobS alongside other pathway enzymes in E. coli

    • Compare cobalamin production with native Salmonella systems

    • This approach has yielded up to 100-fold higher corrin production than parent Salmonella strains

What experimental controls are critical when studying cobS activity?

Rigorous controls are essential for reliable cobS activity studies:

  • Enzyme controls:

    • No-enzyme reactions to establish baseline

    • Heat-inactivated enzyme to confirm enzymatic nature of reaction

    • Concentration gradients to establish linear response range

  • Substrate controls:

    • Omission of individual substrates to confirm specificity

    • Substrate analogs to probe binding pocket requirements

    • Varying substrate concentrations for kinetic analysis

  • Environmental controls:

    • Strict anaerobic versus aerobic conditions (cobalamin synthesis requires anaerobic environment)

    • pH range testing to determine optimal reaction conditions

    • Buffer composition effects on enzyme activity

  • Specificity controls:

    • Testing cobS activity with non-native substrates

    • Competitive inhibitors to confirm active site binding

    • Product identification using multiple analytical methods

  • System validation:

    • Biological activity testing of synthesized products using cobalamin auxotrophs

    • Comparison with commercially available standards

    • Inter-laboratory validation of methods

How should researchers interpret contradictory results in cobS functional studies?

When confronted with inconsistent results in cobS studies, consider these systematic approaches:

  • Verify protein quality:

    • Confirm protein purity by SDS-PAGE and mass spectrometry

    • Assess proper folding using circular dichroism or thermal shift assays

    • Check for proteolytic degradation during storage

  • Scrutinize experimental conditions:

    • Ensure truly anaerobic conditions throughout the experiment

    • Verify all cofactors and substrates are present and active

    • Examine buffer composition, pH, and ionic strength effects

  • Consider strain differences:

    • Genetic variations between Salmonella strains may affect results

    • Confirm whether you're working with S. paratyphi C or related species

    • Sequence verification of the cobS gene in your experimental system

  • Evaluate pathway completeness:

    • For in vivo studies, ensure all necessary genes for cobalamin synthesis are present

    • For in vitro studies, confirm the presence of all required enzymes and substrates

  • Apply rigorous data analysis:

    • Utilize appropriate statistical methods to determine significance

    • Perform meta-analysis when multiple experiments yield different results

    • Consider biological versus technical replicates in experimental design

What are common challenges when working with recombinant cobS and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant cobS:

  • Low protein expression:

    • Optimize codon usage for the expression host

    • Test different expression vectors and promoter strengths

    • Adjust induction parameters (temperature, concentration, duration)

  • Protein insolubility:

    • Reduce expression temperature (16-20°C)

    • Employ solubility-enhancing fusion tags

    • Optimize buffer conditions during purification

    • Consider membrane protein extraction protocols given cobS's transmembrane domains

  • Loss of activity during purification:

    • Include stabilizing agents (glycerol, reducing agents)

    • Minimize purification steps

    • Use gentle elution conditions

    • Maintain anaerobic environment during purification

  • Enzyme activity inconsistencies:

    • Ensure strict anaerobic conditions

    • Verify substrate integrity before each experiment

    • Include all necessary cofactors

    • Consider the effect of buffer composition and pH

  • Storage instability:

    • Store at -80°C with 50% glycerol

    • Aliquot to avoid freeze-thaw cycles

    • Consider adding protease inhibitors

    • Monitor protein stability over time with activity assays

How does Salmonella paratyphi C cobS compare with cobS proteins from other bacterial species?

While the research data doesn't provide direct comparisons, several important inferences can be made:

  • Functional conservation:

    • S. paratyphi C cobS likely shares high functional similarity with S. typhimurium cobS

    • Both function as cobalamin(-5′-phosphate) synthase enzymes in the nucleotide loop assembly pathway

  • Evolutionary relationships:

    • The cobalamin biosynthetic pathway shows significant differences between anaerobic (Salmonella) and aerobic (Pseudomonas) pathways

    • These differences suggest divergent evolution of cobalamin synthesis mechanisms

  • Host adaptation:

    • S. paratyphi C is a human pathogen causing enteric fever

    • cobS function may be optimized for the environment encountered during human infection

    • Comparative genomics could reveal selective pressures acting on cobS

What future research directions should be prioritized for cobS studies?

Several promising research avenues deserve exploration:

  • Structural biology:

    • Determine high-resolution structures of cobS to understand catalytic mechanism

    • Investigate substrate binding through co-crystallization studies

    • Examine conformational changes during catalysis

  • Systems biology approaches:

    • Integrate cobS function into larger metabolic networks

    • Investigate regulatory mechanisms controlling cobalamin synthesis

    • Explore interactions between cobS and other cellular components

  • Synthetic biology applications:

    • Engineer cobS variants with improved catalytic efficiency

    • Develop systems for enhanced cobalamin production

    • Create novel cobamides with altered lower-ligand bases

  • Pathogenesis studies:

    • Investigate the role of cobalamin synthesis in Salmonella virulence

    • Examine cobS expression during different infection stages

    • Explore cobS as a potential antimicrobial target

Table 1: Characteristics of Recombinant Salmonella paratyphi C Cobalamin Synthase (cobS)

ParameterValueReference
UniProt IDC0Q1Q9
Protein Length247 amino acids
Expression SystemE. coli
Molecular TagN-terminal His
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal Storage-20°C/-80°C, 50% glycerol recommended
Alternative NamesCobalamin-5′-phosphate synthase, Adenosylcobinamide-GDP ribazoletransferase

Table 2: Enzymes and Reactions in the Nucleotide Loop Assembly Pathway

EnzymeFunctionSubstrate(s)ProductReference
CobUNTP:adenosylcobinamide phosphotransferaseAdenosylcobinamide + GTPAdenosylcobinamide-GDP
CobTNicotinate mononucleotide:base phosphoribosyltransferase5,6-dimethylbenzimidazole + NaMNα-ribazole-5′-phosphate
CobSCobalamin synthaseAdenosylcobinamide-GDP + α-ribazole-5′-phosphateAdenosylcobalamin−5′-phosphate
CobCPhosphataseAdenosylcobalamin−5′-phosphateAdenosylcobalamin

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.