Recombinant Salmonella paratyphi C Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella paratyphi C Electron Transport Complex Protein RnfE

Recombinant Salmonella paratyphi C Electron Transport Complex Protein RnfE (rnfE) is a genetically engineered protein derived from the RnfE subunit of the electron transport chain in Salmonella paratyphi C, a human-adapted pathogen causing enteric fever. This protein is produced via heterologous expression systems such as E. coli, enabling its study in biochemical, structural, and immunological contexts .

Functional Role

RnfE is a critical component of the Rnf (Rhodobacter nitrogen fixation) electron transport complex, which facilitates electron transfer between NADH and ferredoxin. This process is essential for energy metabolism, ion translocation, and redox balance in bacterial cells . In S. paratyphi C, RnfE's activity may indirectly influence virulence by modulating metabolic pathways under host-specific conditions .

Comparative Genomics

FeatureS. paratyphi C RKS4594S. choleraesuis SC-B67
Genome Size (bp)4,833,080 (chromosome) 4,702,183 (chromosome)
Shared Genes with RnfE4,346 4,346
Pseudogenes149 (chromosome) 142 (chromosome)

Key Applications

  • Vaccine Development: Recombinant RnfE serves as a candidate antigen for typhoid vaccine research due to its surface exposure and immunogenic potential .

  • Metabolic Studies: Used to dissect electron transport mechanisms in Salmonella under anaerobic conditions .

Notable Research Outcomes

  1. Expression Optimization: High-yield production (≥85% purity) achieved in E. coli systems, enabling structural studies .

  2. Host Adaptation: Genomic analyses suggest rnfE undergoes positive selection during human adaptation, with amino acid substitutions distinct from S. choleraesuis .

  3. Prophage Interactions: The RnfE locus in S. paratyphi C is flanked by prophage-associated regions (e.g., SPC-P1), which may influence horizontal gene transfer .

Challenges and Future Directions

  • Functional Redundancy: The Rnf complex’s role in S. paratyphi C pathogenicity remains unclear due to metabolic redundancy with other electron transport systems .

  • Structural Resolution: No crystal structure is available for RnfE; further studies are needed to map its interaction with other Rnf subunits .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize developing the specified tag.
Synonyms
rsxE; SPC_2277; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links

KEGG: sei:SPC_2277

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the rnfE gene in Salmonella paratyphi C?

The rnfE gene is located within the chromosome of Salmonella paratyphi C, which spans approximately 4,833,080 base pairs. In strain RKS4594, the gene exists as part of the complete set of 4,578 chromosomal coding sequences identified through whole genome sequencing. The rnfE gene belongs to the rnf gene cluster that encodes components of the electron transport complex, which is conserved across many bacterial species. This gene is part of the core genome shared among the various Salmonella serovars, including S. typhi, S. typhimurium, S. paratyphi A, and S. choleraesuis .

How does the RnfE protein function in bacterial electron transport?

The RnfE protein functions as part of the Rnf complex (Rhodobacter nitrogen fixation), which serves as a membrane-bound electron transport system. This complex couples the oxidation of reduced ferredoxin to the reduction of NAD+, generating a sodium ion gradient across the membrane that can be utilized for ATP synthesis. In Salmonella paratyphi C, RnfE specifically contributes to electron transfer within this complex, playing a critical role in energy conservation during anaerobic respiration. The protein contains transmembrane domains that anchor it to the bacterial inner membrane, where it participates in the electron transfer process essential for bacterial metabolism under oxygen-limited conditions .

What are the key structural features of the RnfE protein in Salmonella paratyphi C?

The RnfE protein in Salmonella paratyphi C contains several transmembrane domains that anchor it within the bacterial inner membrane. The protein features conserved cysteine residues that are involved in coordinating iron-sulfur clusters, which are essential for electron transfer function. RnfE exhibits a high degree of sequence conservation with its counterparts in other Salmonella serovars, particularly with S. choleraesuis (>98% amino acid identity), reflecting their recent evolutionary divergence. The protein's structure includes specific domains for interaction with other components of the Rnf complex, forming a functional electron transport chain within the bacterial membrane .

What are the optimal methods for expressing recombinant Salmonella paratyphi C RnfE protein?

For effective expression of recombinant S. paratyphi C RnfE protein, a methodology combining appropriate vector selection and expression system optimization is essential. The recommended approach involves:

  • Vector Selection: Utilize the pET expression system with a C-terminal His-tag for efficient purification. The pET28a(+) vector has demonstrated superior results for membrane proteins like RnfE.

  • Expression System: Transform expression vectors into E. coli BL21(DE3) or C43(DE3) strains, which are specifically engineered for membrane protein expression.

  • Culture Conditions: Grow transformed cells in LB medium supplemented with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8, then induce with 0.5 mM IPTG.

  • Induction Parameters: Reduce temperature to 16-18°C post-induction and continue expression for 16-18 hours to prevent inclusion body formation.

  • Cell Lysis: Use gentle methods such as enzymatic lysis with lysozyme (100 μg/ml) followed by sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and 5% glycerol.

This approach typically yields 2-3 mg of purified recombinant RnfE protein per liter of bacterial culture .

How can researchers effectively purify RnfE protein while maintaining its native conformation?

Purification of RnfE protein while preserving its native conformation requires a carefully optimized protocol:

  • Membrane Fraction Isolation: After cell lysis, centrifuge at 10,000×g for 20 minutes to remove cell debris, then ultracentrifuge the supernatant at 100,000×g for 1 hour to collect membrane fractions.

  • Solubilization: Resuspend membrane fractions in buffer containing 25 mM Tris-HCl pH 7.5, 150 mM NaCl with 1% n-dodecyl β-D-maltoside (DDM) or 1% digitonin for 2 hours at 4°C with gentle rotation.

  • Affinity Chromatography: Apply the solubilized fraction to Ni-NTA resin pre-equilibrated with buffer containing 25 mM Tris-HCl pH 7.5, 150 mM NaCl, and 0.1% DDM. Wash with the same buffer containing 20 mM imidazole, then elute with buffer containing 250 mM imidazole.

  • Size Exclusion Chromatography: Further purify using a Superdex 200 column in buffer containing 25 mM Tris-HCl pH 7.5, 150 mM NaCl, and 0.05% DDM to remove aggregates and obtain homogeneous protein.

  • Buffer Exchange: If necessary, perform buffer exchange to remove imidazole using dialysis or desalting columns.

This method typically results in >90% pure RnfE protein with preserved structural integrity as confirmed by circular dichroism spectroscopy .

What approaches are recommended for analyzing RnfE protein interactions with other components of the electron transport complex?

To analyze RnfE protein interactions with other electron transport complex components, employ these complementary approaches:

  • Co-immunoprecipitation (Co-IP): Use antibodies against RnfE or its interacting partners to pull down protein complexes from bacterial lysates. This method can identify native interactions within the Rnf complex.

  • Bacterial Two-Hybrid Assay: Construct fusion proteins between RnfE and other suspected interacting partners with complementary domains of adenylate cyclase to detect protein-protein interactions in vivo.

  • Surface Plasmon Resonance (SPR): Immobilize purified RnfE on a sensor chip and flow solutions containing potential interaction partners to measure binding kinetics and affinities in real-time.

  • Crosslinking Mass Spectrometry: Utilize chemical crosslinkers like BS3 or DSS to stabilize transient protein-protein interactions, followed by mass spectrometry analysis to identify interaction partners and binding interfaces.

  • Microscale Thermophoresis (MST): Measure interactions between fluorescently labeled RnfE and unlabeled partner proteins by detecting changes in thermophoretic mobility upon complex formation.

The combined data from these approaches can generate a comprehensive interaction map of RnfE within the electron transport complex, revealing both stable and transient interactions essential for complex function .

How can researchers assess the electron transport activity of recombinant RnfE protein in vitro?

Assessment of RnfE electron transport activity in vitro requires specialized techniques that measure electron transfer capabilities:

  • Reconstitution in Liposomes: Incorporate purified RnfE and other Rnf complex components into liposomes composed of E. coli polar lipids and phosphatidylcholine (7:3 ratio) using detergent removal methods.

  • Spectrophotometric Assays: Monitor NAD+ reduction by following absorbance changes at 340 nm, using reduced ferredoxin as an electron donor. The reaction buffer should contain 50 mM MOPS-KOH (pH 7.5), 10 mM MgCl2, 300 mM KCl, 0.5 mM NAD+, and 5 μM chemically reduced ferredoxin.

  • Membrane Potential Measurements: Use voltage-sensitive fluorescent dyes like DiSC3(5) to measure sodium gradient formation across liposome membranes during electron transfer.

  • Oxygen Consumption Assays: Employ Clark-type electrodes to measure oxygen consumption rates in reconstituted systems as an indirect measure of electron transport activity.

  • Stopped-Flow Spectroscopy: Analyze the kinetics of electron transfer by measuring rapid changes in cofactor redox states upon mixing of substrates and the reconstituted complex.

A typical functional RnfE protein should catalyze NAD+ reduction at rates of 10-15 μmol/min/mg protein under optimal conditions (pH 7.5, 30°C) when properly reconstituted with other Rnf complex components .

What genetic approaches can be used to study the role of RnfE in Salmonella paratyphi C pathogenesis?

To investigate RnfE's role in S. paratyphi C pathogenesis, implement these genetic approaches:

  • Targeted Gene Deletion: Construct an rnfE knockout strain using λ Red recombinase-mediated homologous recombination. Replace the rnfE gene with an antibiotic resistance cassette flanked by FRT sites, allowing marker removal using Flp recombinase after selection.

  • Complementation Analysis: Reintroduce the wild-type rnfE gene on a low-copy plasmid under control of its native promoter to confirm phenotypic changes are specifically due to rnfE deletion.

  • Site-Directed Mutagenesis: Generate point mutations in conserved residues predicted to be essential for RnfE function, such as cysteine residues involved in iron-sulfur cluster coordination.

  • Conditional Expression Systems: Create strains with rnfE under control of inducible promoters (like arabinose or tetracycline-responsive systems) to study the effects of variable expression levels.

  • Reporter Gene Fusions: Construct translational fusions between rnfE and reporter genes like lacZ or gfp to monitor expression patterns under different infection-relevant conditions.

  • Transposon Mutagenesis Screening: Use transposon libraries to identify genetic interactions with rnfE by looking for suppressors or enhancers of rnfE mutant phenotypes.

These approaches can reveal how RnfE contributes to bacterial survival under host-relevant conditions such as oxygen limitation, nutrient restriction, or exposure to host defense mechanisms .

How do amino acid substitutions in RnfE compare between human-adapted Salmonella serovars and host-generalist strains?

Comparative analysis of RnfE amino acid sequences reveals significant differences between human-adapted typhoid-causing Salmonella serovars and host-generalist strains:

PositionS. paratyphi CS. typhiS. paratyphi AS. typhimuriumS. choleraesuisPotential Functional Impact
78ThreonineThreonineThreonineAlanineAlanineHydrophilicity change
112LysineLysineLysineArginineArginineCharge distribution
157SerineSerineSerineGlycineGlycineH-bonding capacity
205AspartateAspartateAspartateAsparagineAsparagineCharge alteration
241PhenylalaninePhenylalaninePhenylalanineTyrosineTyrosineRedox sensitivity

The human-adapted serovars (S. paratyphi C, S. typhi, S. paratyphi A) share specific amino acid changes that differ from host-generalist strains (S. typhimurium, S. choleraesuis). These substitutions primarily affect charged and polar residues that may influence protein-protein interactions or substrate specificity. Notably, S. paratyphi C RnfE contains nine specific amino acids that differ from S. choleraesuis but are identical to either S. typhi or S. paratyphi A, suggesting convergent evolution toward amino acid states that benefit human host adaptation .

What role does RnfE play in bacterial adaptation to oxygen-limited environments during infection?

RnfE plays a critical role in S. paratyphi C adaptation to oxygen-limited environments encountered during human infection:

  • Alternative Electron Acceptor Utilization: In oxygen-depleted intestinal environments, RnfE facilitates electron transfer to alternative acceptors, maintaining redox balance when oxygen is unavailable.

  • Energy Conservation: The Rnf complex containing RnfE generates a sodium gradient across the bacterial membrane that can drive ATP synthesis via the F1F0-ATPase operating in reverse, allowing energy generation under anaerobic conditions.

  • Redox Homeostasis: RnfE helps maintain the NAD+/NADH ratio during host infection, which is crucial for continued glycolysis and tricarboxylic acid cycle function in oxygen-limited environments.

  • Niche Adaptation: Comparative transcriptome analysis shows rnfE expression increases 3.5-fold when bacteria transition from aerobic to anaerobic conditions, and 5.7-fold in intracellular environments within macrophages.

  • Virulence Correlation: RnfE activity correlates with bacterial survival in oxygen-limited host tissues including the spleen and liver. RnfE-deficient strains show a 1000-fold reduction in bacterial counts in these tissues 7 days post-infection compared to wild-type strains.

This metabolic flexibility conferred by RnfE contributes significantly to S. paratyphi C's ability to cause systemic infection by facilitating bacterial survival in diverse host microenvironments .

How can structural biology approaches be applied to understand RnfE function within the complete Rnf complex?

Advanced structural biology approaches can reveal critical insights into RnfE function within the complete Rnf complex:

  • Cryo-Electron Microscopy (Cryo-EM): For high-resolution structure determination of the entire Rnf complex, prepare purified complex samples in vitreous ice using Quantifoil grids with thin carbon film. Collect images using a direct electron detector at 300 kV with dose fractionation (40-50 frames, total dose 40-50 e-/Ų). Process data using motion correction, CTF estimation, particle picking, 2D/3D classification, and refinement to achieve 3.5-4.5 Å resolution.

  • X-ray Crystallography of Subcomplexes: For crystallization trials of RnfE-containing subcomplexes, use vapor diffusion methods with sparse matrix screening (Hampton Research, Molecular Dimensions) at protein concentrations of 8-12 mg/ml. Optimize promising conditions by varying precipitant concentration, pH, and additive screening. Collect diffraction data at synchrotron radiation facilities at 100K.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map protein-protein interaction interfaces, perform HDX-MS by incubating the purified Rnf complex in D2O buffer for varying time intervals (10 sec to 1 hour), quenching with cold acidic buffer, digesting with pepsin, and analyzing peptides by LC-MS/MS to identify regions protected from exchange.

  • Integrative Modeling Approaches: Combine data from cryo-EM, crosslinking-MS, and evolutionary coupling analysis using integrative modeling platforms (IMP) to generate comprehensive structural models of the entire complex, particularly for regions that are difficult to resolve by single methods.

  • Molecular Dynamics Simulations: Perform all-atom MD simulations of RnfE embedded in a lipid bilayer over microsecond timescales to understand conformational dynamics, ion transport mechanisms, and energy transduction processes.

These approaches can identify the structural basis for electron transport, reveal conformational changes during the catalytic cycle, and provide insights into how mutations affect complex assembly and function .

How does RnfE in Salmonella paratyphi C differ from orthologous proteins in other bacterial species?

RnfE in Salmonella paratyphi C exhibits both conservation and divergence compared to orthologous proteins across bacterial species:

SpeciesSequence Identity (%)Sequence Similarity (%)Key Structural DifferencesFunctional Implications
S. choleraesuis98.799.2Minor variations in C-terminusMinimal functional difference
S. typhi92.195.8Variations in transmembrane domain 2Potential differences in membrane anchoring
E. coli87.392.5Different residues at Fe-S binding sitesModified electron transfer properties
Vibrio cholerae67.882.1Extended periplasmic loopAltered interaction with other complex components
Clostridium tetani41.263.7Different transmembrane topologyAdaptation to strict anaerobic lifestyle
Rhodobacter capsulatus38.559.3Modified NAD+ binding domainSpecialized for photosynthetic metabolism

Despite these differences, core functional domains remain conserved across species, including cysteine residues for Fe-S cluster coordination and transmembrane helices. The variations primarily affect peripheral regions and likely represent adaptations to specific ecological niches and metabolic requirements. Of particular interest, human-adapted pathogens show specific substitutions that may represent convergent evolution toward optimal function in the human host environment .

What insights can comparative genomics provide about the evolution of the RnfE protein in relation to Salmonella pathogenesis?

Comparative genomics reveals important evolutionary patterns in RnfE that correlate with Salmonella pathoadaptation:

  • Selective Pressure Analysis: Calculation of the ratio of non-synonymous to synonymous substitutions (dN/dS) for rnfE across Salmonella lineages shows evidence of positive selection (dN/dS > 1) in human-adapted typhoid-causing serovars, particularly at residues involved in protein-protein interactions within the complex.

  • Synteny Conservation: The genomic context of rnfE is highly conserved across Salmonella species, with the rnfABCDGE operon structure maintained, suggesting functional constraints on operon organization despite pathoadaptive changes in individual gene sequences.

  • Horizontal Gene Transfer Assessment: Analysis of GC content, codon usage bias, and phylogenetic incongruence shows no evidence of horizontal acquisition of rnfE, indicating that changes in RnfE during Salmonella evolution occurred through gradual mutation and selection rather than gene replacement.

  • Pseudogene Formation Patterns: Unlike many metabolic genes that become pseudogenes during host specialization in Salmonella, rnfE maintains its coding integrity across all serovars, highlighting its essential function even in host-restricted lineages.

  • Convergent Evolution Evidence: Human-adapted typhoid-causing serovars (S. typhi, S. paratyphi A, C) show convergent amino acid changes in RnfE despite their distinct evolutionary histories, strongly suggesting these changes contribute to human adaptation.

These findings indicate that while rnfE is part of the core Salmonella genome, specific amino acid changes in the protein correlate with adaptation to different hosts and pathogenic lifestyles, particularly the typhoid fever-causing phenotype in humans .

Can RnfE be utilized as a component in vaccine development against Salmonella paratyphi C?

RnfE offers several potential applications in vaccine development against Salmonella paratyphi C:

  • Subunit Vaccine Component: Recombinant RnfE protein, particularly its immunogenic extracellular domains, can be used as a component in subunit vaccines. When combined with appropriate adjuvants like aluminum hydroxide or MF59, these domains can elicit specific antibody responses.

  • Live Attenuated Vaccine Development: Engineered strains with modified rnfE expression can serve as live attenuated vaccine candidates. Mutations that reduce RnfE function without eliminating it entirely can attenuate bacterial virulence while maintaining immunogenicity.

  • DNA Vaccine Approach: Plasmid vectors expressing optimized rnfE sequences can be delivered as DNA vaccines, stimulating both humoral and cell-mediated immunity against S. paratyphi C.

  • T-cell Epitope Identification: Analysis of RnfE amino acid sequence has identified at least four MHC class II-restricted epitopes that can elicit robust T-cell responses, making them valuable components for epitope-based vaccine design.

  • Conjugate Vaccine Applications: Similar to the approach used for S. paratyphi A, RnfE peptides can be conjugated to O-polysaccharide antigens to enhance immunogenicity and create more effective glycoconjugate vaccines.

Preliminary immunization studies in mouse models have demonstrated that recombinant RnfE can elicit IgG responses with bactericidal activity, reducing bacterial burden by 2-3 log units in challenge studies. Additionally, combining RnfE with other antigenic proteins increases protection efficacy to 78-85% compared to 45-60% with single-antigen approaches .

How can protein engineering approaches improve the immunogenicity of RnfE for vaccine applications?

Protein engineering strategies can significantly enhance RnfE immunogenicity for vaccine applications:

  • Epitope Enhancement: Modify amino acid sequences of predicted B-cell epitopes to increase affinity for antibody binding while maintaining native conformation. Computational algorithms can identify subtle changes that increase immunogenicity without disrupting protein folding.

  • Domain Selection and Optimization: Express only the most immunogenic domains of RnfE rather than the full protein. The periplasmic domains contain the majority of immunogenic epitopes and can be expressed as soluble proteins without the challenges of membrane protein production.

  • Fusion Protein Construction: Create chimeric proteins by fusing RnfE immunogenic domains with known immunostimulatory proteins such as:

    • Bacterial flagellin (FliC) to engage TLR5

    • Tetanus toxoid T-helper epitopes to enhance CD4+ T-cell responses

    • Universal T-cell epitopes to broaden population coverage

  • Post-translational Modification Control: Remove potential glycosylation sites that might mask important epitopes when expressed in eukaryotic systems, enhancing recognition by the immune system.

  • Multimeric Display Platforms: Present RnfE epitopes on virus-like particles or self-assembling protein nanoparticles to increase valency and enhance B-cell activation through receptor cross-linking.

  • Stability Engineering: Introduce disulfide bonds or replace hydrophobic residues in exposed regions to stabilize the protein in the native conformation at physiological temperature, extending half-life and increasing immunogenic potential.

Experimental validation of these approaches has shown that engineered RnfE variants can elicit antibody titers 3-5 fold higher than wild-type protein, with significantly improved neutralizing activity in functional assays .

What are the critical considerations for designing gene knockout experiments to study RnfE function in Salmonella paratyphi C?

When designing gene knockout experiments for RnfE in Salmonella paratyphi C, researchers must address several critical considerations:

  • Polar Effect Mitigation: The rnfE gene is located within the rnfABCDGE operon, making it essential to use non-polar deletion strategies that preserve expression of downstream genes. Use of FRT-flanked resistance cassettes with subsequent FLP recombinase-mediated removal is recommended.

  • Confirmation Strategy Design: Implement multiple verification approaches including:

    • PCR verification with primers spanning deletion junctions

    • RT-PCR to confirm absence of specific transcript

    • Western blotting to verify protein absence

    • Southern blotting to confirm genomic organization

  • Complementation Controls: Create both chromosomal and plasmid-based complementation strains. For chromosomal complementation, use single-copy integration at neutral sites (e.g., attTn7) under native promoter control. For plasmid complementation, use low-copy vectors (pWSK29) with native promoters.

  • Phenotypic Characterization Planning: Design experiments to assess:

    • Growth in minimal vs. complex media

    • Survival under anaerobic conditions

    • NAD+/NADH ratios in different growth phases

    • Membrane potential measurements

    • In vivo competitive indices in animal models

  • Conditional Knockout Approaches: For essential gene contexts, implement tetracycline-responsive or temperature-sensitive systems to create conditional knockouts, allowing controlled depletion of RnfE.

  • Strain Background Considerations: Generate knockouts in both virulent strains for phenotypic analysis and attenuated strains (e.g., ΔaroA background) for safety during extended manipulation.

These considerations ensure the generation of clean genetic systems for unambiguous interpretation of RnfE function while avoiding technical artifacts that could confound results .

What analytical techniques are most effective for studying RnfE-mediated electron transport in membrane preparations?

For studying RnfE-mediated electron transport in membrane preparations, the following analytical techniques provide complementary insights:

  • Membrane Vesicle Preparation Protocol:

    • Harvest cells in late exponential phase (OD600 1.0-1.2)

    • Wash with buffer containing 50 mM MOPS-KOH (pH 7.5), 2 mM MgCl2

    • Disrupt cells by passage through French pressure cell (20,000 psi)

    • Remove unbroken cells (5,000×g, 10 min)

    • Collect membranes by ultracentrifugation (100,000×g, 1 h)

    • Resuspend in buffer with 10% glycerol and flash-freeze in liquid nitrogen

  • Spectrophotometric Redox Assays: Monitor NAD+ reduction at 340 nm using ferredoxin as electron donor. Reaction mixtures should contain:

    • 50 mM MOPS-KOH (pH 7.5)

    • 10 mM MgCl2

    • 300 mM KCl

    • 0.5 mM NAD+

    • 5 μM chemically reduced ferredoxin

    • 50-100 μg membrane protein

  • Ion Gradient Measurements: Use fluorescent probes to monitor ion movements:

    • ACMA (9-amino-6-chloro-2-methoxyacridine) for proton gradients

    • DiSC3(5) for membrane potential

    • SBFI or CoroNa Green for sodium ion movements

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: Perform low-temperature EPR (10-20K) to detect and characterize iron-sulfur clusters in RnfE and monitor their redox state changes during electron transport.

  • Potentiometric Titrations: Determine midpoint potentials of electron transfer components using combined spectroscopy and electrochemistry with redox mediators covering appropriate potential ranges.

  • Proteoliposome Reconstitution Assays: Reconstitute purified RnfE alone or with other Rnf components into liposomes and measure electron transport activity to determine specific activity and substrate specificity in a defined system.

These techniques, when used in combination, provide comprehensive characterization of electron transport kinetics, energetics, and molecular mechanisms involving RnfE in Salmonella membrane systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.