Recombinant Salmonella paratyphi C Fumarate reductase subunit D (frdD)

What is the basic structure and function of Salmonella paratyphi C Fumarate reductase subunit D?

Salmonella paratyphi C Fumarate reductase subunit D (frdD) is a small hydrophobic protein (13 kDa) that serves as one of the four essential subunits of the fumarate reductase complex. The protein consists of 119 amino acids with the sequence: "MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMPLGLFPGDALSFERV LTFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL" . As a membrane-anchoring subunit, frdD works in conjunction with frdC to facilitate membrane association of the fumarate reductase complex, which is critical for anaerobic respiration in Salmonella .

What are the optimal conditions for storage and handling of recombinant Salmonella paratyphi C frdD protein?

Based on manufacturer protocols and research practices, recombinant Salmonella paratyphi C frdD should be stored at -20°C to -80°C for long-term preservation. For lyophilized forms, shelf life extends to approximately 12 months, while liquid preparations remain stable for about 6 months under proper storage conditions . Repeated freeze-thaw cycles significantly reduce protein stability and functionality; therefore, preparation of single-use aliquots is strongly recommended. Working aliquots can be maintained at 4°C for up to one week without significant degradation . When reconstituting lyophilized protein, centrifuge the vial briefly before opening and use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For optimal stability, addition of glycerol to a final concentration of 5-50% (typically 50%) is recommended before aliquoting for long-term storage .

What expression systems are most effective for producing functional recombinant frdD protein?

E. coli expression systems have proven most effective for producing recombinant Salmonella paratyphi C frdD protein with high yield and functionality . When expressing membrane proteins like frdD, several critical factors must be considered: (1) codon optimization based on the expression host, (2) selection of appropriate promoters that allow controlled expression levels to prevent inclusion body formation, and (3) incorporation of suitable affinity tags that don't interfere with protein folding or membrane insertion. For optimal results, the BL21(DE3) E. coli strain with T7 expression systems has shown good performance, especially when expression is conducted at lower temperatures (16-20°C) to facilitate proper folding of this hydrophobic membrane protein. It's worth noting that co-expression with other fumarate reductase subunits, particularly frdC, may enhance proper folding and stability, as research indicates these proteins work in concert and separation affects functional assembly .

How does frdD contribute to the anaerobic survival and pathogenicity of Salmonella paratyphi C?

The frdD subunit plays a critical role in anaerobic survival of Salmonella paratyphi C by enabling functional assembly of the fumarate reductase complex, which serves as the terminal electron acceptor during anaerobic respiration with fumarate as the terminal electron acceptor . This metabolic capability allows Salmonella paratyphi C to survive in oxygen-limited environments, including those encountered during host infection. The pathogenicity connection stems from Salmonella's need to adapt to varying oxygen concentrations in different host tissues, particularly in the oxygen-depleted environment of the intestinal lumen and within macrophage phagosomes. Experimental evidence indicates that strains with dysfunctional fumarate reductase complexes show reduced virulence and impaired host colonization, highlighting the indirect contribution of frdD to pathogenicity . Furthermore, comparative genomic analyses have revealed that Salmonella paratyphi C has undergone significant genetic adaptation during its evolution as a human pathogen, with metabolic genes (including those involved in anaerobic respiration) being subject to selection pressures that enhance survival in the human host .

What is the relationship between frdD expression and antimicrobial resistance in Salmonella pathogens?

Research into the relationship between frdD expression and antimicrobial resistance presents a complex picture. While direct evidence linking frdD to antimicrobial resistance mechanisms is limited, broader research on fumarate reductase suggests several important connections:

• Metabolic adaptation: Under antibiotic stress, bacteria often modify their metabolic pathways, with fumarate reductase activity being upregulated to enhance survival under stress conditions.

• Biofilm formation: Anaerobic respiration genes, including the frd operon, have been implicated in biofilm formation, which significantly increases resistance to antibiotics.

• Persister cell formation: Bacteria in low-energy metabolic states (where fumarate reductase is active) are more likely to form persister cells that exhibit transient antibiotic tolerance.

Unlike Salmonella Typhi, Salmonella Paratyphi A shows less evidence of multidrug resistance and appears to have mechanisms that prevent acquisition or retention of resistance plasmids . Whether similar mechanisms exist in Salmonella paratyphi C and how they might interact with anaerobic respiration pathways require further investigation. Researchers studying these connections should employ transcriptomic approaches to analyze frdD expression under antibiotic stress conditions and create knockout mutants to assess changes in minimum inhibitory concentrations for various antimicrobials.

How conserved is the frdD sequence across Salmonella serovars, and what does this reveal about evolutionary pressure?

Comparative genomic analysis reveals significant conservation of the frdD gene sequence across Salmonella serovars, reflecting its essential metabolic function. When comparing the frdD sequences from S. paratyphi A, S. paratyphi C, and S. choleraesuis:

What functional differences exist between frdD proteins from typhoid-causing versus non-typhoid Salmonella strains?

The functional differences between frdD proteins from typhoid-causing versus non-typhoid Salmonella strains remain incompletely characterized, but genomic and evolutionary analyses provide several insights:

• Sequence variations: Typhoid-causing strains like S. paratyphi C show specific amino acid substitutions in frdD that may contribute to adaptation to the human host environment. Comparative studies of S. paratyphi C RKS4594 and S. choleraesuis SC-B67 identified 2,335 amino acid differences across their proteomes, with metabolic proteins showing significant divergence despite their recent evolutionary separation .

• Expression regulation: Typhoid-causing strains exhibit different regulation of anaerobic metabolism genes, including the frd operon, which may reflect adaptation to the unique environments encountered during systemic infection.

• Functional integration: The frdD protein likely functions in concert with other metabolic adaptations specific to typhoid-causing strains, contributing to their ability to cause systemic infection rather than remaining localized to the intestinal tract.

These differences must be understood in the context of convergent evolution of typhoid virulence - genomic analysis has demonstrated that S. paratyphi C and S. typhi have evolved typhoid-causing abilities independently, despite displaying similar pathogenic traits . This suggests that while their frdD proteins may share functional similarities contributing to anaerobic metabolism, they likely participate in distinct metabolic networks shaped by different evolutionary trajectories.

What are the challenges and solutions for studying membrane-associated frdD protein in functional assays?

Studying membrane-associated proteins like frdD presents several significant challenges that require specialized methodological approaches:

• Protein solubilization and stability: The hydrophobic nature of frdD makes it difficult to solubilize without disrupting its native conformation. Researchers should employ mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin at optimized concentrations to extract the protein while maintaining its functional state. Alternatively, nanodisc or liposome reconstitution systems can provide membrane-like environments for functional studies.

• Complex integrity preservation: Since frdD functions as part of the larger fumarate reductase complex, studying it in isolation may not reflect its natural activity. Co-expression and co-purification with other subunits, particularly frdC, is recommended as research has demonstrated that both proteins are required for proper membrane association and function .

• Activity assays: For functional assessment, researchers can measure quinol oxidation activity coupled to fumarate reduction using artificial electron donors/acceptors like benzyl viologen. Another approach is to complement frd-deficient bacterial strains and assess restoration of anaerobic growth on glycerol and fumarate media .

• Structural studies: For structural characterization, cryo-electron microscopy has proven more successful than X-ray crystallography for membrane protein complexes. Depending on research goals, site-directed spin labeling combined with electron paramagnetic resonance spectroscopy can provide insights into conformational changes during enzyme activity.

How can researchers effectively use recombinant frdD in vaccine development against Salmonella paratyphi C?

Utilizing recombinant frdD in vaccine development against Salmonella paratyphi C requires consideration of several methodological approaches:

• Antigenicity assessment: Researchers should first evaluate the immunogenicity of frdD through computational epitope prediction tools combined with experimental validation using ELISA and T-cell activation assays. While membrane proteins like frdD are not typically prime vaccine candidates due to limited exposure to the immune system, certain epitopes may be immunologically relevant.

• Delivery system optimization: For effective delivery, recombinant frdD can be:

  • Incorporated into outer membrane vesicles (OMVs)

  • Displayed on virus-like particles

  • Formulated with adjuvants that enhance immune responses against bacterial antigens (e.g., aluminum salts or TLR agonists)

• Combination strategies: Research indicates that more effective vaccines against Salmonella paratyphi C will likely require multiple antigens. Studies should assess frdD in combination with established immunogenic candidates, particularly O-antigen components which are unique to specific Salmonella serovars .

• Attenuated live vector approaches: Rather than using purified recombinant frdD, researchers might consider engineering attenuated Salmonella strains with modified frdD expression as live vaccines. This approach leverages the natural infection process while controlling virulence . When developing such strains, the established knowledge that all four fumarate reductase subunits are essential for anaerobic growth suggests that controlled expression of frdD could contribute to effective attenuation while maintaining immunogenicity.

• Protective efficacy evaluation: Vaccine candidates should be evaluated in appropriate animal models, with challenge studies measuring bacterial burden in target organs, immunological responses, and survival rates.

It's important to note that while the O2-antigen has been identified as a primary vaccine target for S. paratyphi A due to its uniqueness , equivalent specific targets for S. paratyphi C require further characterization. Any vaccine development program should include comparative genomic analysis to identify antigens that provide serovar-specific protection.