Recombinant Salmonella paratyphi C Large-conductance mechanosensitive channel (mscL)

What is Salmonella paratyphi C and how does it relate to other typhoid agents?

Salmonella paratyphi C is one of the few Salmonella serovars that causes typhoid, a potentially fatal systemic infection, unlike the majority of the 1400+ Salmonella serovars that typically cause self-limited gastroenteritis in humans. Genomic analysis reveals that S. paratyphi C has diverged from a common ancestor with S. choleraesuis (primarily a swine pathogen) by accumulating genomic novelty during adaptation to humans . Interestingly, S. paratyphi C does not share a common ancestor with other human-adapted typhoid agents such as S. typhi, supporting the convergent evolution model of typhoid agents . This evolutionary distinction is evidenced by the fact that S. paratyphi C shares 4346 genes with S. choleraesuis but only 4008 genes with S. typhi .

What is the mscL protein in S. paratyphi C and what is its function?

The Large-conductance mechanosensitive channel (mscL) in S. paratyphi C is a membrane protein encoded by the mscL gene (SPC_3479). The protein consists of 137 amino acids with the sequence: MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLISGIDFKQFAFTLREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEEVLLGEIRDLLKEQNNRS .

Functionally, mscL serves as a pressure-relief valve that responds to membrane tension. When bacteria experience osmotic downshock, these channels open to release cytoplasmic solutes, preventing cell lysis. This mechanism is critical for bacterial survival during environmental transitions, making it an important protein for understanding bacterial adaptation and potentially for antimicrobial targeting.

How does the genome of S. paratyphi C RKS4594 differ from other Salmonella strains?

S. paratyphi C strain RKS4594 contains a chromosome of 4,833,080 bp and a plasmid of 55,414 bp . The genome includes 4,640 intact coding sequences (4,578 in the chromosome and 62 in the plasmid) and 152 pseudogenes (149 in the chromosome and 3 in the plasmid) . A comparative analysis with other sequenced Salmonella strains reveals significant genomic differences:

The genetic distance between S. paratyphi C and S. choleraesuis is strikingly short, indicating their very recent divergence, while there is a much greater distance from S. paratyphi C to S. paratyphi A, S. typhi, or S. typhimurium .

What evidence supports the convergent evolution model of typhoid pathogenesis in S. paratyphi C?

Multiple genomic analyses strongly support the convergent evolution model:

• Phylogenetic tree comparison of 3691 genes shared by all six sequenced Salmonella strains placed S. paratyphi C and S. choleraesuis together at one end, and S. typhi at the opposite end, demonstrating separate ancestries of human-adapted typhoid agents .

• Differential nucleotide substitutions between S. paratyphi C and S. choleraesuis suggest enormous selection pressure during adaptation to humans .

• Comparison of 3238 proteins common to all six Salmonella genomes identified 2335 amino acids that differ between S. paratyphi C and S. choleraesuis. Of these, 2222 amino acids are identical in S. typhi, S. paratyphi A, and S. typhimurium, representing the ancestral state .

• S. paratyphi C has 1147 of these ancestral amino acids, while S. choleraesuis has 1028, suggesting differential selection pressures driving adaptation to different niches .

• Nine specific amino acids in S. paratyphi C RKS4594 differ from S. choleraesuis but are identical to those in human-adapted S. typhi or S. paratyphi A, suggesting convergent adaptation to the human host .

What methods are recommended for cloning and expressing recombinant S. paratyphi C mscL?

For cloning and expressing recombinant S. paratyphi C mscL, researchers should consider the following methodological approach:

• Gene amplification: The mscL gene can be PCR-amplified from genomic DNA of S. paratyphi C using high-fidelity DNA polymerase. Based on similar cloning strategies used for other S. paratyphi genes, recommended PCR conditions include: 5 cycles of 98°C 10s, 55°C 15s, 72°C 1min; followed by 25 cycles of 98°C 10s, 68°C 1min .

• Vector selection: For initial cloning, a low-copy vector (similar to pSTV28a used for viaB cloning) is recommended to minimize potential toxicity issues that might arise from membrane protein overexpression .

• Expression system: E. coli BL21(DE3) or a similar strain designed for recombinant protein expression is suitable. For membrane proteins like mscL, consider using C41(DE3) or C43(DE3) strains that are optimized for membrane protein expression.

• Induction conditions: IPTG induction at lower temperatures (16-25°C) is often beneficial for proper folding of membrane proteins. A concentration range of 0.1-0.5 mM IPTG with induction times of 4-16 hours is recommended.

• Protein extraction: For membrane proteins, detergent-based extraction is necessary. Common detergents include n-Dodecyl β-D-maltoside (DDM), n-Octyl-β-D-glucopyranoside (OG), or Triton X-100.

• Purification strategy: Affinity chromatography using His-tag or other fusion tags, followed by size-exclusion chromatography, is effective for obtaining pure protein.

What are the key considerations for studying mscL function in S. paratyphi C?

Studying mscL function requires specialized techniques due to its nature as a mechanosensitive channel:

• Patch-clamp electrophysiology: This technique allows direct measurement of channel activity. Giant spheroplasts or reconstituted proteoliposomes can be used to study single-channel properties.

• Osmotic downshock assays: These functional assays assess the ability of mscL to protect bacterial cells from osmotic lysis. Cells expressing functional mscL will show higher survival rates after hypoosmotic shock compared to deletion mutants.

• Fluorescence-based techniques: Fluorescent dye release assays using mscL reconstituted into liposomes can measure channel activity in response to membrane tension.

• Structural studies: Techniques such as X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance can provide insights into the structural basis of mscL function.

• Computational modeling: Molecular dynamics simulations can complement experimental approaches by predicting channel gating mechanisms and responses to membrane tension.

How might recombinant mscL be utilized in vaccine development against S. paratyphi C?

Using recombinant mscL in vaccine development presents several promising strategies:

• Subunit vaccine component: As a membrane protein, mscL could serve as an antigenic component in subunit vaccines. Research on S. paratyphi A has identified several outer membrane proteins with significant immunoprotection, achieving protection rates of 70-95% in mouse models . A similar approach could be applied to mscL from S. paratyphi C.

• Delivery system for other antigens: Recombinant mscL could potentially be engineered as a delivery system for other protective antigens, similar to approaches used with other membrane proteins.

• Live attenuated vaccine platforms: The mscL gene could be modified in live attenuated S. paratyphi C vaccine candidates to enhance attenuation while maintaining immunogenicity. This approach is conceptually similar to the engineering of Vi capsular polysaccharide into S. paratyphi A for creating bivalent vaccines .

• Adjuvant properties: Bacterial membrane components often have adjuvant properties; mscL could potentially enhance immune responses when co-administered with other antigens.

• Cross-protection potential: If mscL epitopes are conserved across pathogenic Salmonella strains, it might contribute to broader protection against multiple serovars.

The development approach would need to follow a pathway similar to other experimental vaccines, involving:

• Preclinical immunogenicity and protection studies in animal models

• Safety assessment

• Dose optimization

• Evaluation of administration routes

• Assessment of protective immune responses

What challenges are associated with developing human infection models for S. paratyphi C research?

Developing human infection models for S. paratyphi C research presents several specific challenges:

• Ethical considerations: As demonstrated in S. paratyphi A human challenge models, strict eligibility criteria are essential to minimize risk to participants and their contacts . These studies require comprehensive ethical approval processes.

• Dose determination: A carefully calibrated bacterial dose is critical. For S. paratyphi A models, researchers aimed for an "attack rate" of 60-75%, using an a priori decision-making algorithm to escalate or de-escalate doses . Similar approaches would be needed for S. paratyphi C.

• Endpoint definition: Clear clinical and microbiological endpoints must be established. In S. paratyphi A models, infection is defined by positive blood cultures and/or sustained fever exceeding 38°C for at least 12 hours .

• Safety monitoring: Comprehensive monitoring protocols are required, including frequent blood, stool, saliva, and urine sampling to track infection progression .

• Antibiotic treatment protocols: Well-defined antibiotic intervention strategies are necessary. For S. paratyphi A models, ciprofloxacin (500 mg twice daily for 14 days) was used upon diagnosis or after the follow-up period .

• Long-term safety considerations: Protocols must address the risk of chronic carriage. This includes exclusion of participants with gallbladder disease and obtaining weekly stool samples after antibiotic completion until two successive samples are negative .

• Public health measures: Coordination with local health protection units is essential to prevent community transmission .

What are the regulatory considerations for laboratory work with S. paratyphi C and recombinant mscL?

Laboratory work with S. paratyphi C and recombinant mscL must adhere to specific biosafety and regulatory requirements:

• Biosafety level: S. paratyphi C is typically handled at Biosafety Level 2 (BSL-2) with enhanced practices due to its potential to cause serious human disease. Work involving large volumes or concentrated cultures may require BSL-3 practices.

• Laboratory containment: Standard microbiological practices with particular attention to preventing aerosol generation and ingestion are essential.

• Decontamination protocols: Validated decontamination procedures for workspaces, equipment, and waste must be implemented. Autoclave sterilization is typically required for all contaminated materials.

• Personnel monitoring: Regular health monitoring for laboratory workers is recommended, particularly following potential exposure incidents.

• Transportation regulations: Transportation of S. paratyphi C and derived materials must comply with international (e.g., IATA Dangerous Goods Regulations) and national transportation regulations for infectious substances.

• Genetic modification regulations: Work with recombinant mscL falls under genetic modification regulations in most jurisdictions, requiring appropriate risk assessments and possibly regulatory notifications or permits.

• Record keeping: Detailed records of all work, including storage locations of strains and derived materials, must be maintained.

What public health measures are necessary for controlling S. paratyphi C infections?

Comprehensive public health measures for controlling S. paratyphi C infections include:

• Case management: According to regulatory guidelines, cases cannot attend child care facilities or participate in occupations involving food handling, patient care, or care of children/elderly until fecal specimens are Salmonella-free on three consecutive specimens collected at least 24 hours apart and not sooner than 48 hours after antibiotic discontinuation .

• Health officer supervision: Cases must be supervised by a health officer and can only be released from supervision after three consecutive negative fecal cultures taken not less than 24 hours apart, not sooner than 48 hours after antibiotic discontinuation, and not earlier than 1 month after onset or first positive culture .

• Long-term carrier management: If a person continues to excrete S. paratyphi after 12 months, additional management protocols apply .

• Contact control: Household, sexual, and other close contacts of cases may not attend child care facilities or work in sensitive occupations until two consecutive negative fecal cultures are obtained .

• Infection control: Healthcare providers must implement standard precautions when managing cases .

• Antibiotic susceptibility testing: For all S. paratyphi isolates, testing should include ampicillin, a fluoroquinolone, and trimethoprim-sulfamethoxazole. For extra-intestinal isolates, a third-generation cephalosporin should also be tested .

• Surveillance: Ongoing surveillance is essential for monitoring antibiotic resistance trends, as multi-drug resistant and carbapenem-resistant isolates have been reported .

Bibliography

• Liu W-Q, Feng Y, Wang Y, et al. Salmonella paratyphi C: Genetic Divergence from Salmonella choleraesuis and Pathogenic Convergence with Salmonella typhi. PLoS ONE. 2009;4(2):e4510.

• Li P, Liu Q, Luo H, et al. Vi Capsular Polysaccharide Produced by Recombinant Salmonella enterica serovar Paratyphi A Confers Immunoprotection against Infection by Salmonella enterica serovar Typhi. Front Microbiol. 2017;8:936.

• McCullagh D, Dobinson HC, Darton T, et al. Understanding paratyphoid infection: study protocol for the development of a human model of Salmonella enterica serovar Paratyphi A challenge in healthy adult volunteers. BMJ Open. 2015;5(6):e007481.

• Pan Z, Zhang X, Geng S. Paratyphoid Fever A: Infection and Prevention. Front Microbiol. 2022;13:945235.

• CSB-CF508533SWU ELISA Recombinant Salmonella paratyphi C Large-conductance mechanosensitive channel(mscL). Colorectal Research.

• Abbott S, Janda J. Salmonella, Shigella, and Yersinia. In: Clinical Microbiology Procedures Handbook, Fourth Edition. 2015.

• Liu W-Q, Feng Y, Wang Y, et al. Salmonella paratyphi C: Genetic Divergence from Salmonella choleraesuis and Pathogenic Convergence with Salmonella typhi. PLOS ONE. 2009;4(2):e4510.

• Md. Code Regs. 10.06.01.21 - Typhoid Fever (Salmonella Typhi) and Paratyphoid Fever (Salmonella Paratyphi A, Salmonella Paratyphi B tartrate negative, and Salmonella Paratyphi C). Cornell Law School.