Recombinant Salmonella paratyphi C Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Salmonella Paratyphi C Lipoprotein Signal Peptidase (LspA) is a bacterial enzyme critical for processing lipoproteins, which are essential for virulence and host-pathogen interactions. LspA, a type II signal peptidase (SPase II), cleaves the signal peptide of prolipoproteins after lipid modification, enabling their integration into bacterial membranes or secretion . This enzyme has garnered attention for its role in bacterial pathogenesis and potential applications in vaccine development .

Enzymatic Activity

  • Globomycin Resistance Assay: Recombinant LspA confers resistance to globomycin, a SPase II inhibitor, in E. coli . This confirms its functional homology to SPase II enzymes in other Gram-negative bacteria.

  • Genetic Complementation: Complements temperature-sensitive E. coli mutants defective in lipoprotein processing, though with lower efficiency compared to E. coli LspA (~5-fold difference) .

Role in Pathogenesis

  • Lipoprotein Processing: LspA processes ~14 predicted lipoproteins in S. Paratyphi C, which are critical for immune evasion and nutrient acquisition .

  • Host Adaptation: Genomic comparisons reveal lspA is highly conserved in S. Paratyphi C and closely related serovars like S. Choleraesuis, suggesting its role in host-specific adaptation .

Immunogenicity Studies

  • Recombinant LspA elicits strong IgG responses in animal models when adjuvanted with alum or Freund’s incomplete adjuvant .

  • ELISA Validation: The protein is used in diagnostic assays to detect anti-lipoprotein antibodies, with high specificity confirmed via Western blot .

Bacterial Vector Engineering

  • Attenuated Salmonella strains expressing recombinant LspA have been explored as vaccine carriers. For example:

    • Vi Polysaccharide-Producing Strains: S. Paratyphi A engineered with viaB (Vi antigen locus) and lspA deletions showed stable antigen production and immunogenicity .

    • Dual-Antigen Systems: Co-expression of LspA with other virulence factors (e.g., O-antigens) enhances cross-protection against Salmonella serovars .

Expression Systems

  • Prokaryotic Hosts: Optimized in E. coli BL21(DE3)pLysS using IPTG induction .

  • Yield: ~1–2 mg/L culture under standard conditions .

Challenges

  • Solubility Issues: Requires Tris-based buffers with 50% glycerol to maintain stability .

  • Post-Translational Modifications: Absence of native lipid modifications in recombinant forms may limit functional studies .

Table 2: Genomic Context of lspA in Salmonella Serovars

SerovarlspA ConservationPseudogenes NearbyVirulence Plasmid Association
S. Paratyphi C100%149Yes (pSPCV)
S. Choleraesuis98%62Yes (pKDSC50)
S. Typhi89%204No

Data derived from comparative genomic studies .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve catalytic mechanisms and inhibitor binding sites.

  • Therapeutic Targeting: Development of LspA-specific antibiotics to combat multidrug-resistant Salmonella strains.

  • Multivalent Vaccines: Integration of recombinant LspA with O-antigen conjugates (e.g., O:2-CRM<sub>197</sub>) for broader protection .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please specify it in your order remarks. We will fulfill your request based on availability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
lspA; SPC_0049; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
lspA
Target Protein Sequence
MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGNWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: sei:SPC_0049

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of lipoprotein signal peptidase (LspA) in Salmonella species?

LspA is a type II signal peptidase (SPase II) that plays an essential role in bacterial lipoprotein processing. It specifically cleaves the signal peptide from prolipoproteins after they have been lipid-modified by prolipoprotein diacylglyceryl transferase (Lgt). This processing step is critical for bacterial viability, as properly processed lipoproteins are essential components of the bacterial cell envelope and contribute significantly to pathogenesis .

In Salmonella, as with other Gram-negative bacteria, LspA facilitates the maturation of lipoproteins that function in diverse cellular processes including nutrient acquisition, cell division, and interactions with host cells. The enzyme is particularly important for intracellular growth and virulence, making it both a valuable research target and a potential therapeutic target .

How is LspA gene expression regulated during different phases of bacterial growth and infection?

LspA expression exhibits differential patterns during various stages of bacterial growth and infection. Research in Rickettsia, another intracellular pathogen, demonstrates that lspA transcription varies significantly throughout infection cycles . In particular, higher transcriptional levels of lspA, along with lgt (encoding prolipoprotein transferase) and lepB (encoding type I signal peptidase), are observed at the pre-infection stage, indicating that only metabolically active bacteria are capable of initiating infection .

What are the optimal methods for cloning and expressing recombinant S. paratyphi C LspA?

When cloning and expressing recombinant S. paratyphi C LspA, researchers should consider the following methodological approach:

  • Gene isolation: PCR amplification of the lspA gene from S. paratyphi C genomic DNA using primers designed based on conserved sequences found in related Salmonella serovars.

  • Expression vector selection: For membrane proteins like LspA, specialized vectors with appropriate fusion tags (such as His6 or MBP) that facilitate purification while maintaining protein folding and functionality are recommended.

  • Expression system optimization: E. coli BL21(DE3) or C41/C43 strains are preferred for membrane protein expression. Induction conditions should be carefully optimized (temperature, IPTG concentration, and induction duration) to maximize yield while preventing inclusion body formation.

  • Membrane extraction protocols: Gentle detergent-based extraction methods using non-ionic detergents like DDM or LDAO are essential for solubilizing LspA while preserving its native conformation and enzymatic activity.

The choice of expression system must balance yield with maintaining the native structure and function of this integral membrane protein. When validating expression, Western blotting with antibodies against the fusion tag or LspA itself, combined with activity assays, provides confirmation of successful recombinant protein production.

What assays can be used to measure LspA enzymatic activity in vitro?

Several robust assays are available for measuring LspA enzymatic activity:

  • SDS-PAGE gel-shift assay: This widely used method tracks the cleavage of signal peptides from prolipoproteins by observing molecular weight shifts on SDS-PAGE. For example, prepro inhibitor of cysteine protease (ppICP) can be first processed by Lgt using dioleoylphosphatidylglycerol (DOPG) as lipid substrate, followed by LspA cleavage, resulting in an observable molecular weight shift of approximately 10 kDa . The signal intensity of the processed product can be quantified to determine enzyme activity and inhibition.

  • Fluorescence-based assays: Synthetic peptide substrates containing the lipobox motif can be conjugated to fluorophore/quencher pairs, with fluorescence increase upon cleavage.

  • Mass spectrometry: LC-MS/MS analysis provides precise quantification of substrate and product formation, particularly useful for detailed kinetic studies.

  • Radiometric assays: Using radiolabeled lipoprotein precursors to track processing through autoradiography, providing high sensitivity.

When conducting these assays, it's crucial to carefully control reaction conditions (pH, temperature, detergent concentration) as they significantly impact LspA activity. Additionally, parallel negative controls using catalytically inactive LspA mutants help validate assay specificity.

How can researchers distinguish between LspA activity and other signal peptidases in experimental systems?

Distinguishing LspA (type II signal peptidase) activity from other signal peptidases (particularly type I signal peptidases like LepB) requires careful experimental design:

  • Substrate specificity: Use substrates with characteristic lipobox motifs that are specifically recognized by LspA. Type II signal peptidases recognize the lipobox consensus sequence [LVI][ASTVI][GAS][C], with the conserved cysteine being essential for recognition.

  • Sequential processing verification: Since proper LspA function requires prior processing by Lgt, experiments can be designed to verify the lipid modification prerequisite. In properly designed assays, LspA will only process substrates that have been previously modified by Lgt .

  • Specific inhibitors: Employ specific inhibitors like globomycin that selectively target type II signal peptidases without affecting type I signal peptidases . This allows researchers to confirm activity attribution through inhibition studies.

  • Genetic approaches: Use bacterial strains with lspA gene deletions complemented with recombinant LspA to ensure that observed activity is specifically due to the recombinant protein.

  • Activity across different pH ranges: Type I and type II signal peptidases often have different pH optima, which can be exploited for differentiation.

A rigorous approach combines multiple methods to conclusively attribute observed activity to LspA rather than other peptidases present in the experimental system.

What are the challenges in developing selective inhibitors of S. paratyphi C LspA for therapeutic applications?

Developing selective inhibitors against S. paratyphi C LspA presents several significant challenges:

  • Membrane protein targeting: As an integral membrane protein, LspA presents accessibility barriers for inhibitors, requiring compounds with appropriate physicochemical properties to penetrate the bacterial membrane while maintaining selectivity.

  • Structural conservation: The high degree of conservation in the catalytic domains of bacterial signal peptidases complicates the design of inhibitors that specifically target S. paratyphi C LspA without affecting other bacterial species or host enzymes.

  • Resistance mechanisms: Bacteria may develop resistance through mutations in the lspA gene, altered expression of efflux pumps, or compensatory mechanisms in lipoprotein processing pathways.

  • In vivo efficacy: Transitioning from in vitro activity to in vivo efficacy remains challenging due to pharmacokinetic/pharmacodynamic considerations and the intracellular lifestyle of Salmonella.

  • Validation methodologies: Confirming target engagement in whole cells requires specialized techniques beyond simple enzymatic assays.

Recent approaches have shown promise, including the computational design of cyclic peptide inhibitors of bacterial signal peptidases that demonstrate specific inhibition in gel-shift assays . Compounds like G2a and G2d have shown specific inhibitory activity against LspA, providing potential scaffolds for further development .

How can comparative analysis of LspA across different pathogens inform S. paratyphi C research?

Comparative analysis of LspA across different bacterial pathogens provides valuable insights for S. paratyphi C research through several approaches:

  • Evolutionary conservation analysis: Alignment of LspA sequences from diverse bacterial species reveals highly conserved residues and domains essential for enzymatic function . These conservation patterns help identify critical structural features that can inform mutational studies and inhibitor design for S. paratyphi C LspA.

  • Expression pattern comparison: Studies in Rickettsia reveal differential expression patterns of lspA, lgt, and lepB during infection cycles . Similar analyses in Salmonella serovars can illuminate how S. paratyphi C regulates lipoprotein processing during different stages of infection.

  • Serovar-specific adaptations: Research on S. Paratyphi A demonstrates how specific virulence factors like FepE modulate host inflammatory responses . Comparative studies between S. paratyphi C and other serovars can reveal unique adaptations in lipoprotein processing that contribute to host specificity and virulence.

  • Inhibitor cross-reactivity analysis: Evaluating how inhibitors like globomycin affect LspA across different bacterial species helps identify structural differences that can be exploited for selective targeting of S. paratyphi C LspA .

This comparative approach enables researchers to leverage insights from well-studied bacterial systems to accelerate understanding of S. paratyphi C LspA biology and identify novel research directions.

What factors affect the solubility and stability of recombinant S. paratyphi C LspA?

As an integral membrane protein, recombinant S. paratyphi C LspA presents significant challenges for solubility and stability. Key factors affecting these properties include:

  • Detergent selection: The choice of detergent critically impacts LspA solubility and activity. Generally, mild non-ionic detergents (DDM, LDAO) better preserve functionality compared to harsh ionic detergents (SDS).

  • Expression temperature: Lower temperatures (16-25°C) during induction often improve proper folding and decrease inclusion body formation.

  • Buffer composition:

    • pH optimization (typically 7.0-8.0)

    • Ionic strength (150-300 mM NaCl typical)

    • Glycerol addition (10-15%) to enhance stability

    • Reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Fusion partners: Solubility-enhancing tags (MBP, SUMO, or TrxA) can dramatically improve expression and solubility.

  • Storage conditions: Flash-freezing small aliquots with cryoprotectants minimizes freeze-thaw damage during storage.

Researchers should systematically optimize these parameters through small-scale expression and solubility screens before scaling up production. Additionally, performing thermal shift assays can identify conditions that maximize stability, which is particularly important for structural and enzymatic studies.

How can researchers address inconsistent results in LspA activity assays?

Inconsistent results in LspA activity assays typically stem from several common sources:

  • Substrate preparation variability:

    • Ensure consistent lipid modification of substrates by Lgt before LspA assays

    • Standardize substrate:lipid ratios when preparing prolipoprotein substrates

    • Verify substrate quality by mass spectrometry before enzymatic assays

  • Enzyme stability issues:

    • Monitor protein stability during purification and storage

    • Avoid repeated freeze-thaw cycles

    • Consider adding stabilizing agents (glycerol, specific lipids)

  • Assay condition variations:

    • Strictly control temperature, pH, and ionic strength

    • Standardize detergent concentrations, as detergent micelles can affect enzyme kinetics

    • Establish precise time points for measurements in kinetic studies

  • Quantification challenges:

    • When using gel-shift assays, implement consistent image acquisition and analysis protocols

    • For fluorescence-based assays, include internal calibration standards

    • Always run positive and negative controls in parallel

A systematic troubleshooting approach involves creating a detailed experimental record documenting all variables, implementing a design of experiments (DoE) approach to identify critical parameters, and standardizing protocols with appropriate controls. For the SDS-PAGE gel-shift assay specifically, consistent sample preparation and loading, standardized electrophoresis conditions, and uniform staining/destaining protocols are essential for reproducible quantification .

What are the best practices for analyzing structure-function relationships in S. paratyphi C LspA?

Investigating structure-function relationships in S. paratyphi C LspA requires a multidisciplinary approach:

  • Rational mutagenesis strategy:

    • Target conserved residues identified through sequence alignments across bacterial species

    • Focus on catalytic site residues, substrate-binding regions, and transmembrane domains

    • Create alanine-scanning libraries across regions of interest

    • Design charge-reversal mutations to probe electrostatic interactions

  • Functional characterization methods:

    • Enzymatic assays using gel-shift approaches to quantify activity

    • Substrate binding studies using isothermal titration calorimetry or surface plasmon resonance

    • Thermal stability assessments using differential scanning fluorimetry

  • Structural analysis techniques:

    • Cryo-electron microscopy for membrane protein structure determination

    • X-ray crystallography (challenging for membrane proteins but potentially feasible with LspA)

    • Molecular dynamics simulations to model protein dynamics and substrate interactions

  • Complementation studies:

    • In vivo functional rescue experiments using LspA mutants in lspA-deficient bacteria

    • Assessment of bacterial phenotypes including growth, morphology, and virulence

  • Correlation analysis:

    • Statistical methods to correlate structural features with experimental activity data

    • Machine learning approaches to identify non-obvious structure-function relationships

By systematically combining these approaches, researchers can develop comprehensive models of how specific structural elements contribute to S. paratyphi C LspA function, providing insights for both fundamental understanding and inhibitor development.

How might CRISPR-Cas9 technology advance functional studies of S. paratyphi C LspA?

CRISPR-Cas9 technology offers transformative approaches for studying S. paratyphi C LspA through:

  • Precise genomic modifications:

    • Generation of clean knockout mutants without polar effects

    • Introduction of point mutations to study specific residues

    • Creation of epitope-tagged versions for localization and interaction studies

    • Engineering of conditional expression systems to study essentiality

  • Regulatory element manipulation:

    • Modification of promoter regions to alter expression levels

    • Investigation of expression dynamics during infection by creating reporter fusions

    • Identification of regulatory elements controlling lspA expression

  • High-throughput functional genomics:

    • CRISPR interference (CRISPRi) to achieve partial knockdown for essential genes

    • CRISPR activation (CRISPRa) to upregulate expression

    • CRISPR screening to identify genetic interactions with lspA

  • In vivo infection models:

    • Real-time tracking of bacteria with modified lspA during infection

    • Tissue-specific or temporal control of lspA expression during pathogenesis

These approaches would significantly advance our understanding of how LspA contributes to S. paratyphi C virulence mechanisms, potentially revealing how differential expression patterns during infection stages contribute to pathogenesis, similar to observations in other bacterial systems .

What potential exists for developing diagnostic tools based on S. paratyphi C LspA?

LspA-based diagnostics for S. paratyphi C offer promising possibilities for improving typhoid fever detection:

  • Serological approaches:

    • Development of antibody detection assays targeting unique epitopes of S. paratyphi C LspA-processed lipoproteins

    • Creation of antigen detection systems using antibodies against conserved and variable regions of LspA

  • Molecular detection methods:

    • Design of PCR primers targeting serovar-specific regions of the lspA gene

    • LAMP (Loop-mediated isothermal amplification) assays for point-of-care testing

    • CRISPR-Cas12/13-based detection systems for rapid, sensitive identification

  • Activity-based probes:

    • Development of chemical probes that selectively label active LspA

    • Fluorogenic substrates that become activated upon processing by S. paratyphi C LspA

  • Metabolomic signatures:

    • Identification of unique lipoprotein processing products as biomarkers

    • Mass spectrometry protocols to detect these signature molecules in patient samples

The development of such diagnostic tools would address a significant clinical need, as current methods for differentiating Salmonella serovars are often time-consuming and lack sensitivity. The essential nature of LspA and its conserved function across bacteria suggests it could serve as a stable diagnostic target with potential applications in antimicrobial susceptibility testing as well.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.