Recombinant Salmonella paratyphi C Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Salmonella paratyphi C Membrane Protein Insertase YidC (yidC) is a biotechnologically engineered protein critical for studying bacterial membrane protein biogenesis and vaccine development. YidC belongs to the conserved Oxa1/YidC/Alb3 family of membrane insertases, facilitating the integration and folding of transmembrane proteins in prokaryotic and eukaryotic systems . This recombinant variant, expressed in E. coli, retains the functional and structural properties of the native protein, making it indispensable for biochemical and immunological research .

Functional Roles in Membrane Protein Biogenesis

YidC operates via two pathways:

  1. Sec-YidC Holocomplex: Assists Sec translocon in folding multi-pass membrane proteins (e.g., lactose permease) .

  2. YidC-Only Pathway: Independently inserts single-pass proteins (e.g., phage coat proteins) and tail-anchored proteins (e.g., TssL) .

Key Functions:

  • Membrane Insertion: Guides nascent polypeptides into the lipid bilayer via a hydrophilic cavity .

  • Chaperone Activity: Ensures proper folding of substrates like cytochrome o oxidase and F1_1Fo_o ATPase .

  • Proton-Motive Force Maintenance: Depletion disrupts respiratory complexes, reducing PMF and triggering the Psp stress response .

Vaccine Development

  • Immunogenicity: S. paratyphi C YidC is explored as a vaccine candidate due to its surface exposure and role in pathogenicity .

  • ELISA/Western Blot: Used to detect anti-YidC antibodies in typhoid fever studies .

Mechanistic Studies

  • Cryo-EM Insights: Structural models reveal YidC-ribosome interactions during co-translational insertion of substrates like FO_Oc .

  • Genetic Complementation: Alanine mutagenesis (e.g., T362A, Y517A) inactivates YidC, confirming critical residues for function .

Physiological Impact of YidC Depletion

  • PMF Reduction: Loss of cytochrome o oxidase and F1_1Fo_o ATPase activity decreases PMF by ~50% .

  • Stress Response Induction: Activates the PspA stress protein, indicating membrane damage .

Evolutionary Conservation

  • Homologs: Mitochondrial Oxa1 and chloroplast Alb3 share YidC’s TM core, underscoring its universal role in membrane biogenesis .

  • Genomic Plasticity: S. paratyphi C strains exhibit diverse genome structures, potentially linked to YidC-regulated virulence factors .

Future Directions

  • Therapeutic Targeting: Essential oils like eugenol downregulate yidC, suggesting antimicrobial potential .

  • Structural Dynamics: Further cryo-ET studies are needed to resolve YidC-substrate interactions in native membranes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
yidC; SPC_3929; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-548
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
yidC
Target Protein Sequence
MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQTQQTTQTTTTAAGSAADQGVPASGQGKM ITVKTDVLDLTINTRGGDVEQALLPAYPKELGSNEPFQLLETTPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAFVLADGQNELQVPMTYTDAAGNTFTKTFVFKRGDYAVNVNYSV QNTGEKPLEVSTFGQLKQSVNLPPHRDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNVSSKGGWVAMLQQYFATAWIPRNDGTNNFYTANLGNGIVAIGYKAQPVLVQPGQT SAMTSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRQSQEMMALYKAEKVNPL GGCFPLIIQMPIFLALYYMLMGSIELRHAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the membrane. It participates in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as some lipoproteins. It also aids in the folding of multispanning membrane proteins.
Database Links

KEGG: sei:SPC_3929

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its fundamental role in bacterial cells?

YidC is a critical membrane protein insertase responsible for the proper insertion and folding of proteins into the cytoplasmic membrane of bacteria. It plays an essential role in maintaining membrane integrity and function. YidC can operate in two distinct modes: either in conjunction with the Sec translocon or independently as a standalone insertase for specific substrates (known as YidC-only substrates) . Beyond its insertase function, YidC also serves as a foldase, promoting the proper assembly of membrane protein complexes and facilitating correct interactions between transmembrane helices . This dual functionality makes YidC indispensable for bacterial survival, as it ensures that membrane proteins adopt their functional conformations.

How is the structure of YidC organized in Salmonella species?

The YidC protein in Salmonella species consists of five conserved transmembrane (TM) helices arranged in a pentagonal pattern. Based on evolutionary co-variation analysis and molecular dynamics simulations, these helices are arranged clockwise in the order 4-5-3-2-6 when viewed from the cytoplasm . The transmembrane core forms a stable helical bundle with hydrophobic residues on the exterior that interact with lipid tails, while the interior contains both polar/charged residues (on the cytoplasmic side) and aromatic residues (on the periplasmic side) . Additionally, YidC contains a notable structural feature called the "helical paddle domain" (HPD) formed by a helical hairpin in the cytoplasmic loop between TM2 and TM3 . This domain appears to be relatively mobile and interacts with lipid headgroups, potentially playing a role in substrate recognition or membrane interaction.

What experimental approaches are commonly used to study YidC function?

Several experimental approaches have proven valuable for investigating YidC function:

  • In vivo complementation assays: These are used to assess the functional significance of specific residues by creating alanine mutants and testing their ability to complement YidC deficiency .

  • Structural analyses: Techniques including evolutionary co-variation analysis, lipid-versus-protein-exposure prediction, and molecular dynamics simulations have been employed to develop structural models of YidC .

  • Molecular dynamics simulations: These computational approaches help assess protein stability, inter-residue interactions, and dynamic behaviors of YidC within the membrane environment .

  • Interaction energy analysis: This method identifies key stabilizing residues within the protein structure by calculating interaction energies between residues over simulation trajectories .

  • Membrane thinning analysis: This technique examines how YidC affects the surrounding lipid bilayer structure, providing insights into its membrane integration mechanism .

What critical residues determine YidC function based on molecular dynamics studies?

Molecular dynamics simulations and functional studies have identified several residues critical for YidC function. The following table summarizes key residues and their functional significance:

ResidueLocationEffect of Alanine MutationProposed Function
T362TM2Complete inactivationCore stabilization at cytoplasmic side
Y517TM6Complete inactivationCore stabilization at cytoplasmic side
F433TM regionIntermediate activitySecondary stabilization
M471TM regionIntermediate activitySecondary stabilization
F505TM regionIntermediate activitySecondary stabilization

Analysis of the YidC structure reveals a pattern of residue distribution that contributes to its stability and function: hydrophobic residues on the exterior stabilize interactions with lipid tails, while the core is stabilized through both short and long-range interactions between the five helices . The cytoplasmic side contains primarily polar or charged residues engaged in electrostatic or charge-dipole interactions, whereas the periplasmic side features mainly aromatic residues involved in stacking and other nonpolar dispersion interactions . This asymmetric distribution is likely crucial for the insertase/foldase mechanism.

How does YidC contribute to the biogenesis of penicillin binding proteins in Salmonella?

YidC plays a critical role in the biogenesis of penicillin binding proteins (PBPs), which are essential for peptidoglycan synthesis in bacterial cell walls. PBPs typically contain one transmembrane segment and a large periplasmic or extracellular domain . Research has demonstrated that in the absence of YidC, two critical PBPs fail to fold correctly, even though the total amount of protein in the membrane remains unaffected . This suggests that YidC functions not only in membrane insertion but specifically as a foldase for the periplasmic domains of these proteins.

The mechanism likely involves YidC interacting with the transmembrane domains of PBPs after their release from the Sec translocon, facilitating proper folding of the periplasmic domain . This extends our understanding of YidC's function beyond membrane protein insertion to include a critical role in ensuring the functional maturation of proteins with substantial extramembrane domains. Since PBPs are targets for β-lactam antibiotics and essential for bacterial survival, this YidC-dependent folding pathway represents a potential target for antimicrobial development.

What computational methods are most effective for structural prediction of YidC in Salmonella?

Several computational approaches have proven valuable for predicting YidC structure:

  • Evolutionary co-variation analysis: This method identifies pairs of residues that have co-evolved, suggesting spatial proximity in the folded protein . It has been particularly successful in predicting helix-helix contacts in YidC, with seven helix-helix contacts achieving probabilities above 57% while all other possible contacts scored below 15% .

  • Lipid vs. protein exposure prediction: This approach helps determine the orientation of transmembrane helices by predicting which residues face the lipid bilayer versus the protein interior .

  • MODELLER software with structural restraints: After positioning the transmembrane helices based on covariation analysis, MODELLER was used with additional structural restraints from direct residue-residue interactions and secondary structure predictions to generate complete models .

  • Molecular dynamics simulations: NAMD 2.9 software with the CHARMM36 force field was employed to simulate YidC in a membrane environment (3:1 POPE:POPG lipid composition), allowing assessment of model stability and refinement of structural details .

  • Interaction energy analysis: Computing interaction energies between residues over simulation trajectories helped identify key stabilizing interactions within the protein structure .

The combination of these approaches has proven highly effective, producing a YidC structural model that remains stable during simulations and is consistent with experimental data from functional studies .

How has YidC evolved differently in typhoid-causing Salmonella compared to non-typhoidal strains?

The evolution of YidC in typhoid-causing Salmonella strains like S. paratyphi C may reflect adaptations specific to their human host and systemic infection strategy. While the search results don't directly address YidC evolution across Salmonella serovars, they provide insights into the broader evolutionary patterns of typhoid-causing strains.

S. paratyphi C has diverged from a common ancestor with S. choleraesuis (primarily a swine pathogen) by accumulating genomic changes during adaptation to humans . Genome comparison reveals that S. paratyphi C shares 4,346 genes with S. choleraesuis but only 4,008 genes with another human-adapted typhoid agent, S. typhi . This suggests that different typhoid-causing Salmonella strains have evolved their pathogenic traits independently through convergent evolution rather than from a common typhoid-causing ancestor .

The specialization of S. paratyphi C to cause systemic infections in humans appears to have involved:

  • Differential nucleotide substitutions

  • Accumulation of distinct pseudogenes

  • Acquisition of genomic insertions

  • Loss of certain genes

Given YidC's essential role in membrane protein biogenesis, any evolutionary changes in this protein would likely reflect adaptations to the specific host environment and pathogenic lifestyle of S. paratyphi C.

What role might YidC play in the assembly of virulence factors in Salmonella paratyphi C?

YidC likely plays a crucial role in the assembly of virulence factors in S. paratyphi C, particularly those associated with the virulence plasmid pSPCV. This plasmid shares high sequence identity with virulence plasmids from other Salmonella strains, including pSLT from S. typhimurium LT2 . Many virulence factors are membrane-associated proteins that would require YidC for proper insertion and folding.

As a membrane protein insertase and foldase, YidC could be involved in:

  • Assembly of secretion systems: Type III secretion systems and other protein export apparatuses crucial for virulence require proper membrane integration of multiple components.

  • Integration of adhesins and invasins: Surface-displayed proteins that mediate host cell attachment and invasion would likely depend on YidC for membrane insertion.

  • Biogenesis of nutrient acquisition systems: Systems for iron uptake and other nutrient acquisition mechanisms often involve membrane proteins that might require YidC.

  • Assembly of membrane protein complexes: YidC has been shown to promote the proper assembly of membrane protein complexes such as the MalFGK2 maltose transporter and the MscL homopentameric pore , suggesting it may play a similar role for virulence-associated complexes.

The specialized adaptation of S. paratyphi C to cause systemic human infections might involve specific adaptations in YidC to efficiently process typhoid-specific virulence factors, though direct experimental evidence for this specialization is not provided in the search results.

What protocols are recommended for expression and purification of recombinant YidC?

Based on the available literature and standard practices for membrane protein biochemistry, the following methodological approach is recommended for expression and purification of recombinant YidC from Salmonella paratyphi C:

  • Expression system selection: E. coli BL21(DE3) or C43(DE3) strains are often preferred for membrane protein expression. The latter is specifically engineered for toxic membrane proteins.

  • Vector design: Incorporate a C-terminal His-tag or other affinity tag that doesn't interfere with membrane insertion. Consider using pET or pBAD vector systems with tunable expression.

  • Expression conditions:

    • Grow cells at lower temperatures (16-25°C) after induction

    • Use lower inducer concentrations (0.1-0.5 mM IPTG or 0.002-0.02% arabinose)

    • Add 5-10% glycerol to the growth medium to stabilize membranes

  • Membrane isolation:

    • Harvest cells and disrupt by French press or sonication

    • Remove unbroken cells and debris by low-speed centrifugation

    • Isolate membrane fraction by ultracentrifugation (100,000×g for 1 hour)

  • Solubilization:

    • Solubilize membranes with mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or digitonin

    • Use detergent concentration at 1% for initial solubilization, then reduce to critical micelle concentration (CMC) for purification steps

  • Purification:

    • Affinity chromatography using Ni-NTA for His-tagged constructs

    • Size exclusion chromatography to remove aggregates and ensure monodispersity

    • Consider adding lipids (0.1-0.5 mg/ml) during purification to maintain protein stability

  • Quality control:

    • SDS-PAGE and Western blotting to verify purity and identity

    • Circular dichroism to confirm secondary structure integrity

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify oligomeric state

This protocol should be optimized based on specific research requirements and the particular properties of Salmonella paratyphi C YidC.

What biophysical techniques are most suitable for characterizing YidC-substrate interactions?

Several biophysical techniques are particularly valuable for investigating YidC-substrate interactions:

  • Site-specific crosslinking:

    • Incorporate photo-activatable or chemical crosslinkers at specific positions

    • Identify interaction sites between YidC and substrate proteins

    • Can be combined with mass spectrometry for detailed mapping

  • Fluorescence resonance energy transfer (FRET):

    • Label YidC and substrate with appropriate fluorophore pairs

    • Monitor real-time binding in native-like membrane environments

    • Can provide information on binding kinetics and conformational changes

  • Surface plasmon resonance (SPR):

    • Immobilize either YidC or substrate protein on sensor chip

    • Measure binding affinities and kinetics in detergent or nanodisc environments

    • Provides quantitative binding parameters (kon, koff, KD)

  • Isothermal titration calorimetry (ITC):

    • Determine thermodynamic parameters of binding

    • No labeling required

    • Can detect heat changes associated with conformational rearrangements

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Identify specific residues involved in interactions

    • Monitor chemical shift perturbations upon substrate binding

    • Can provide dynamic information about the interaction

  • Cryo-electron microscopy (Cryo-EM):

    • Visualize YidC-substrate complexes at near-atomic resolution

    • Capture different states of the insertion/folding process

    • Particularly valuable for larger substrate complexes

  • Native mass spectrometry:

    • Determine stoichiometry of YidC-substrate complexes

    • Can be performed in detergent micelles or nanodiscs

    • Provides information on complex stability and composition

The selection of techniques should be guided by the specific research question, the properties of the substrate protein, and the available resources. Often, a combination of complementary approaches yields the most comprehensive insights into YidC-substrate interactions.

How can researchers design effective in vivo assays to assess YidC function in Salmonella?

Designing effective in vivo assays to assess YidC function in Salmonella paratyphi C requires careful consideration of both the essential nature of YidC and the specific aspects of function being investigated. The following methodological approaches are recommended:

  • Conditional depletion systems:

    • Place chromosomal yidC under control of an inducible promoter

    • Gradually deplete YidC by removing inducer

    • Monitor effects on cell growth, morphology, and membrane protein composition

    • This approach circumvents the lethality of complete YidC deletion

  • Complementation assays:

    • Generate a conditional YidC depletion strain

    • Introduce plasmids expressing wild-type or mutant YidC variants

    • Assess ability of variants to restore growth and normal phenotype

    • This approach has been successfully used to identify critical residues like T362 and Y517

  • Reporter substrate systems:

    • Construct fusion proteins between known YidC substrates and reporters (GFP, luciferase, β-galactosidase)

    • Monitor localization, folding, or activity of the reporter as a proxy for YidC function

    • Can be used to study specific aspects of insertion vs. folding activity

  • Proteomics analysis:

    • Compare membrane proteome composition under normal conditions vs. YidC depletion

    • Identify proteins whose membrane integration depends on YidC

    • Quantitative approaches like SILAC can provide detailed insights

  • Virulence assays:

    • Test YidC-depleted or mutant strains in cellular infection models

    • Assess impact on invasion, intracellular survival, and virulence factor secretion

    • Can reveal links between YidC function and pathogenicity

  • Specific substrate analysis:

    • Focus on penicillin binding proteins (PBPs) known to depend on YidC for proper folding

    • Monitor PBP folding state using activity-based probes or conformation-specific antibodies

    • Assess impact on peptidoglycan synthesis and cell wall integrity

These assays should be designed with appropriate controls and can be combined to provide comprehensive insights into YidC function in Salmonella paratyphi C.

What are the emerging research priorities for understanding YidC in Salmonella pathogens?

Several key research priorities emerge for advancing our understanding of YidC in Salmonella pathogens:

  • Typhoid-specific adaptations: Investigate whether YidC in typhoid-causing Salmonella strains has evolved specific features that contribute to their unique pathogenicity. Comparative studies between S. paratyphi C, S. typhi, and non-typhoidal Salmonella would be valuable.

  • Host-pathogen interface: Explore how YidC-dependent membrane proteins contribute to host-pathogen interactions, particularly in the context of systemic infection. This includes investigating the role of YidC in the biogenesis of proteins involved in host immune evasion.

  • Antimicrobial targeting: Develop strategies to target YidC or YidC-dependent processes as novel antimicrobial approaches. Given the essentiality of YidC and its role in virulence factor assembly, this represents a promising therapeutic avenue.

  • Systems biology integration: Position YidC within the broader context of Salmonella membrane biology using systems approaches. This includes understanding how YidC function is coordinated with other membrane protein biogenesis pathways.

  • Structural biology advances: Determine high-resolution structures of Salmonella YidC in complex with physiologically relevant substrates to understand the insertion/folding mechanism at the atomic level.

  • Substrate specificity determinants: Identify the features that determine which proteins are processed by YidC and how substrate recognition occurs in the context of Salmonella infection.

  • Environmental adaptation: Investigate how YidC function may be modulated in response to environmental conditions encountered during infection, such as acidic pH, antimicrobial peptides, or nutrient limitation.

Addressing these research priorities will provide critical insights into the fundamental biology of Salmonella pathogens and potentially reveal new strategies for combating typhoid fever and other Salmonella infections.

How might YidC function be targeted for antimicrobial development?

YidC represents a promising target for novel antimicrobial development based on several key considerations:

  • Essential function: YidC is essential for bacterial viability, making it an attractive antibacterial target. Inhibitors that disrupt YidC function would likely have bactericidal activity.

  • Conservation and differentiation: While YidC is conserved across bacteria, it differs significantly from its eukaryotic counterparts (Oxa1 in mitochondria and Alb3 in chloroplasts), potentially allowing for selective targeting.

  • Accessibility: As a membrane protein with exposed domains on both sides of the membrane, YidC presents multiple potential binding sites for inhibitors.

  • Critical residues: Molecular dynamics studies have identified specific residues (e.g., T362 and Y517) that are essential for YidC function . These could serve as specific targets for small-molecule inhibitors.

  • Impact on virulence: YidC's role in the assembly of virulence factors suggests that partial inhibition could attenuate pathogenicity even without complete growth inhibition.

Potential strategies for targeting YidC include:

  • Small molecule inhibitors that bind to critical residues in the hydrophilic groove

  • Peptide-based inhibitors that mimic substrate interactions and competitively inhibit YidC

  • Compounds that disrupt YidC-Sec translocon interactions

  • Molecules that trap YidC in non-functional conformations

Screening approaches might include:

  • Structure-based virtual screening using the YidC model

  • High-throughput assays based on reporter YidC substrates

  • Fragment-based drug discovery targeting specific functional regions

Development of YidC inhibitors would represent a novel class of antibiotics with potential activity against multidrug-resistant pathogens, including typhoid-causing Salmonella strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.