Recombinant Salmonella paratyphi C NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) in Salmonella paratyphi C?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of the NADH dehydrogenase I complex (NDH-1) in Salmonella paratyphi C. This protein consists of 100 amino acids and plays an essential role in the respiratory chain of this pathogen. The amino acid sequence of this protein is: MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG . As a membrane-embedded subunit, nuoK participates in electron transport and energy production processes that are vital for bacterial survival and pathogenicity.

How does nuoK differ between Salmonella paratyphi C and other Salmonella species?

The nuoK protein in Salmonella paratyphi C shows distinct evolutionary characteristics compared to its counterparts in other Salmonella species. Genomic analysis reveals that S. paratyphi C shares greater genetic similarity with S. choleraesuis (a swine pathogen) than with other human-adapted typhoid agents like S. typhi. Among 2222 amino acids common to S. typhi, S. paratyphi A, and S. typhimurium, S. paratyphi C has maintained 1147 of these, while S. choleraesuis has kept 1028, indicating differential selective pressures during their evolutionary adaptation to different hosts . These differences in protein sequence reflect the adaptation process that has allowed S. paratyphi C to successfully colonize human hosts.

What is the genomic context of the nuoK gene in Salmonella paratyphi C?

The nuoK gene in Salmonella paratyphi C is located within the chromosome (4,833,080 bp) of the organism. It is part of the nuo operon that encodes the multiple subunits of the NADH dehydrogenase I complex. Genome sequencing of S. paratyphi C strain RKS4594 has revealed that this pathogen contains 4,640 intact coding sequences (4,578 in the chromosome and 62 in the plasmid) and 152 pseudogenes . The genomic organization of the nuo operon is conserved across Salmonella species, though specific nucleotide substitutions have occurred during host adaptation processes.

What are the optimal conditions for expressing recombinant Salmonella paratyphi C nuoK protein?

For optimal expression of recombinant Salmonella paratyphi C nuoK protein, researchers should consider the following methodological approach:

• Expression System: E. coli is the preferred heterologous host system for nuoK expression due to its compatibility with Salmonella genes .

• Fusion Tags: Adding an N-terminal His-tag facilitates purification while maintaining protein functionality.

• Growth Conditions: Following transformation of the expression vector into E. coli, cultures should be grown at 37°C until mid-log phase (OD₆₀₀ of 0.6-0.8), then induced with an appropriate concentration of IPTG (typically 0.5-1.0 mM) depending on the expression vector.

• Incubation Period: Post-induction incubation at a lower temperature (16-25°C) for 16-20 hours often improves the yield of correctly folded membrane proteins.

• Lysis Conditions: Since nuoK is a membrane protein, detergent-based lysis buffers containing agents such as n-dodecyl β-D-maltoside (DDM) or Triton X-100 are essential for efficient extraction.

This protocol maximizes protein yield while maintaining the structural integrity necessary for downstream functional studies.

What purification strategies are most effective for recombinant nuoK protein?

Purification of recombinant His-tagged nuoK protein can be achieved through the following optimized protocol:

• Affinity Chromatography: Utilizing Ni-NTA resin for capture of the His-tagged protein, with binding buffer containing 20 mM Tris-HCl (pH 8.0), 500 mM NaCl, 20 mM imidazole, and appropriate detergent (0.05% DDM).

• Washing Steps: Progressive washing with increasing imidazole concentrations (50-80 mM) to remove non-specifically bound proteins.

• Elution: Elution with buffer containing 250-300 mM imidazole.

• Secondary Purification: Size exclusion chromatography using a Superdex 200 column to separate protein aggregates and achieve higher purity.

• Buffer Exchange: Final preparation in Tris/PBS-based buffer with 6% trehalose at pH 8.0 for optimal stability .

The purified protein can be stored as a lyophilized powder or in solution with 50% glycerol at -20°C/-80°C to maintain stability for extended periods.

How should researchers handle the reconstitution of lyophilized nuoK protein?

When working with lyophilized recombinant nuoK protein, follow these methodology-focused steps for optimal reconstitution:

• Pre-Reconstitution Preparation: Centrifuge the vial briefly to ensure all content is at the bottom before opening.

• Reconstitution Solution: Use deionized sterile water to reconstitute the protein to a concentration of 0.1-1.0 mg/mL.

• Stabilization: Add glycerol to a final concentration of 5-50% to enhance stability during storage (with 50% being optimal for long-term preservation).

• Aliquoting: Divide the reconstituted protein into small working aliquots to avoid repeated freeze-thaw cycles, which can compromise protein integrity.

• Storage: Store working aliquots at 4°C for up to one week, and long-term storage aliquots at -20°C/-80°C .

This methodical approach ensures maximum retention of protein structure and function after reconstitution, which is critical for subsequent experimental applications.

How can researchers design experiments to study the role of nuoK in Salmonella paratyphi C pathogenesis?

To investigate the role of nuoK in S. paratyphi C pathogenesis, researchers should implement a multi-faceted experimental approach:

• Gene Knockout Studies:

  • Create precise nuoK deletion mutants using CRISPR-Cas9 or λ-Red recombinase systems

  • Complement the deletion with wild-type nuoK to confirm phenotype specificity

  • Assess changes in bacterial growth, respiration, and virulence phenotypes

• Site-Directed Mutagenesis:

  • Target specific amino acids that differ between S. paratyphi C and other Salmonella species

  • Focus on the nine amino acids in S. paratyphi C that differ from S. choleraesuis but match human-adapted typhoid agents

  • Evaluate the impact of these mutations on protein function and pathogenicity

• In vitro Infection Models:

  • Use human cell lines (e.g., intestinal epithelial cells, macrophages) to assess invasion and intracellular survival

  • Compare wild-type, mutant, and complemented strains under standardized conditions

  • Quantify differences in bacterial adherence, invasion, and replication rates

• Transcriptomic Analysis:

  • Implement RNA-seq to identify genes differentially expressed in the absence of functional nuoK

  • Compare expression profiles during different growth phases and infection stages

  • Correlate findings with known virulence pathways

This comprehensive approach enables researchers to elucidate the specific contributions of nuoK to S. paratyphi C's adaptation to human hosts and its role in typhoid pathogenesis.

What approaches can be used to study the structural properties of nuoK and its interactions within the respiratory complex?

For advanced structural analysis of nuoK and its interactions, researchers should consider these methodological approaches:

• Membrane Protein Crystallography:

  • Optimize detergent conditions for crystal formation

  • Use lipidic cubic phase (LCP) crystallization methods

  • Implement heavy atom derivatives for phase determination

• Cryo-Electron Microscopy:

  • Purify the entire NADH dehydrogenase I complex with intact nuoK

  • Optimize sample preparation with appropriate detergents or nanodiscs

  • Collect high-resolution data to determine subunit arrangements

• Cross-linking Mass Spectrometry:

  • Apply chemical cross-linkers to capture protein-protein interactions

  • Perform enzymatic digestion followed by LC-MS/MS analysis

  • Identify interaction sites between nuoK and other subunits

• Molecular Dynamics Simulations:

  • Create atomistic models of nuoK within the membrane environment

  • Simulate protein dynamics and conformational changes

  • Investigate potential energy transfer mechanisms

• Hydrogen-Deuterium Exchange Mass Spectrometry:

  • Map solvent-accessible regions of the protein

  • Identify conformational changes upon substrate binding

  • Characterize dynamic regions within the protein structure

These approaches, when used in combination, provide comprehensive insights into the structural basis of nuoK function within the respiratory complex.

How should researchers interpret contradictory data when studying nuoK function?

When confronted with contradictory data in nuoK research, implement this systematic interpretation framework:

• Data Validation:

  • Verify experimental methodology for potential technical artifacts

  • Confirm protein integrity via Western blot or mass spectrometry

  • Assess whether the His-tag might influence protein function

• Experimental Variables Analysis:

  • Examine differences in experimental conditions (pH, temperature, ionic strength)

  • Evaluate the impact of different expression systems or purification methods

  • Consider bacterial strain variations that might influence results

• Alternative Hypotheses Development:

  • Formulate new hypotheses that accommodate conflicting data points

  • Design critical experiments to specifically test these alternative explanations

  • Consider dual or context-dependent functions of nuoK

• Comparative Analysis:

  • Contrast findings with data from orthologous proteins in related species

  • Analyze whether contradictions align with known evolutionary adaptations

  • Implement a phylogenetic framework to interpret functional differences

• Combined Methods Approach:

  • Integrate biochemical, genetic, and structural approaches to resolve contradictions

  • Utilize complementary techniques to validate key findings

  • Consider whether contradictions might reveal new aspects of protein function

This structured approach transforms contradictory data from a challenge into an opportunity for deeper scientific understanding of nuoK function.

How has nuoK evolved during Salmonella paratyphi C's adaptation to humans?

The evolution of nuoK in Salmonella paratyphi C reflects the broader evolutionary history of this human-adapted pathogen. Detailed analysis reveals:

• Selective Pressure Analysis:

  • The nuoK gene exhibits a higher ratio of non-synonymous to synonymous substitutions (dN/dS) compared to other respiratory genes, indicating positive selection during host adaptation

  • Specific amino acid changes have been selected to optimize function in the human host environment

• Comparative Genomics Evidence:

  • S. paratyphi C shares 4,346 genes with S. choleraesuis but only 4,008 genes with S. typhi, demonstrating its closer evolutionary relationship to the swine pathogen

  • This pattern supports the convergent evolution model where S. paratyphi C and other human-adapted typhoid agents acquired similar pathogenic traits independently

• Phylogenetic Positioning:

  • Analysis of 3,691 genes shared by six sequenced Salmonella strains places S. paratyphi C and S. choleraesuis together at one phylogenetic branch, separate from S. typhi

  • This confirms that S. paratyphi C evolved from a common ancestor with S. choleraesuis relatively recently

• Host Adaptation Signatures:

  • Nine specific amino acids in S. paratyphi C differ from S. choleraesuis but match those in other human-adapted Salmonella, suggesting their importance for human host adaptation

  • These convergent amino acid changes likely contribute to the typhoid pathogenesis mechanism

This evolutionary understanding provides crucial context for interpreting nuoK's functional role in human infection.

What functional differences exist between nuoK in Salmonella paratyphi C and related proteins in other bacterial species?

Functional comparison of nuoK across bacterial species reveals important adaptations:

The functional differences in nuoK reflect broader metabolic adaptations that enable S. paratyphi C to:

• Survive within human macrophages through optimized respiratory function

• Maintain energy production under the low-oxygen conditions of infected tissues

• Support the systemic spread characteristic of typhoid fever

These adaptations represent a fascinating example of how subtle protein modifications can contribute to major shifts in pathogen host range and disease manifestation.

What statistical methods are appropriate for analyzing nuoK functional data?

When analyzing experimental data related to nuoK function, researchers should employ these methodological statistical approaches:

• Differential Expression Analysis:

  • For RNA-seq or proteomic data involving nuoK: Apply DESeq2 or edgeR with appropriate false discovery rate (FDR) correction

  • Implement a minimum fold-change threshold (typically ≥1.5) combined with adjusted p-value ≤0.05

  • Validate key findings using qRT-PCR with appropriate reference genes

• Protein-Protein Interaction Analysis:

  • For co-immunoprecipitation or cross-linking experiments: Apply SAINT (Significance Analysis of INTeractome) algorithm

  • Calculate enrichment ratios relative to appropriate controls

  • Implement hierarchical clustering to identify interaction networks

• Structure-Function Relationship Analysis:

  • For mutagenesis studies: Use multiple regression models to correlate amino acid changes with functional parameters

  • Implement ANOVA with post-hoc tests to compare multiple mutant variants

  • Consider evolutionary conservation scores as covariates in the analysis

• Growth/Virulence Phenotype Analysis:

  • For bacterial growth curves: Apply mixed-effects models to account for experimental replicates

  • For survival data: Implement Kaplan-Meier analysis with log-rank tests

  • For bacterial burden: Use non-parametric tests (Mann-Whitney) when data don't meet normality assumptions

• Handling Contradictory Data:

  • Implement meta-analytic approaches to integrate conflicting results

  • Use Bayesian methods to incorporate prior knowledge when appropriate

  • Apply sensitivity analyses to identify influential experimental variables

These rigorous statistical approaches ensure robust interpretation of nuoK functional data while minimizing false positives and negatives.

How can researchers design controls to ensure the specificity of nuoK-related phenotypes?

To establish causality and specificity in nuoK research, implement this comprehensive control strategy:

• Genetic Controls:

  • Clean deletion mutant (ΔnuoK) with minimal polar effects

  • Complementation with wild-type nuoK under native promoter

  • Complementation with catalytically inactive nuoK (point mutation)

  • Empty vector control for complementation studies

• Protein Expression Controls:

  • Western blot verification of nuoK expression levels

  • Inclusion of epitope tags that don't interfere with function

  • Membrane fraction isolation to confirm proper localization

  • Enzymatic activity assays of the respiratory complex

• Phenotypic Specificity Controls:

  • Comparison with mutations in other NADH dehydrogenase subunits

  • Metabolic rescue experiments (alternative electron donors/acceptors)

  • Growth under fermentative vs. respiratory conditions

  • Chemical inhibition of specific respiratory chain components

• Host Cell Interaction Controls:

  • Comparison with known virulence gene mutants

  • Cell type specificity (epithelial cells vs. macrophages)

  • Cytotoxicity measurements to ensure host cell viability

  • Inhibitor studies to block specific host cell processes

• Technical Controls:

  • Multiple biological replicates (minimum n=3)

  • Independent experimental verification using alternative methods

  • Randomization of sample processing to avoid batch effects

  • Blinded analysis of critical outcome measurements

This systematic control framework ensures that observed phenotypes can be confidently attributed to nuoK function rather than experimental artifacts or secondary effects.

How can nuoK research contribute to understanding Salmonella paratyphi C pathogenesis?

Research on nuoK provides multiple avenues for understanding S. paratyphi C pathogenesis:

• Metabolic Adaptation Insights:

  • nuoK function directly impacts bacterial energy production during infection

  • Studies can reveal how S. paratyphi C adjusts its metabolism to survive within host cells

  • Comparisons with non-typhoidal Salmonella can highlight typhoid-specific adaptations

• Host-Pathogen Interaction Mechanisms:

  • nuoK activity influences bacterial responses to host defense mechanisms

  • Research can elucidate how respiratory chain function supports intracellular survival

  • Understanding how nuoK contributes to bacterial persistence during chronic infection

• Evolutionary Convergence Analysis:

  • nuoK represents a model for studying convergent evolution in typhoid agents

  • Research can identify parallel adaptations across independently evolved human pathogens

  • Comparative studies with S. typhi can reveal common mechanisms of host adaptation

• Systems Biology Integration:

  • nuoK research connects metabolism, virulence, and adaptation

  • Network analysis can position nuoK within the broader pathogenesis program

  • Multi-omics approaches can reveal regulatory interactions affecting nuoK expression

These research directions collectively enhance our understanding of how S. paratyphi C causes typhoid fever and provide insights into the evolution of host adaptation in bacterial pathogens.

What are promising future research directions for nuoK studies?

Future research on nuoK should explore these high-potential directions:

• Single-Cell Analysis:

  • Implement single-cell RNA-seq to characterize nuoK expression heterogeneity during infection

  • Develop fluorescent reporters to track nuoK activity in real-time during infection

  • Correlate nuoK expression with bacterial cell fate in host tissues

• Structure-Guided Drug Development:

  • Resolve high-resolution structures of nuoK and the respiratory complex

  • Identify potential binding pockets for small-molecule inhibitors

  • Develop species-specific inhibitors based on unique structural features

• Host Adaptation Mechanisms:

  • Perform comprehensive mutagenesis of human adaptation-associated residues

  • Test chimeric proteins containing domains from multiple Salmonella species

  • Evaluate the functional impact of natural polymorphisms in clinical isolates

• Metabolic Integration:

  • Map metabolic flux in the presence and absence of functional nuoK

  • Investigate metabolic interactions between nuoK activity and virulence factor expression

  • Develop computational models predicting nuoK's role in different infection microenvironments

• Immunological Interactions:

  • Investigate how nuoK activity influences pathogen-associated molecular pattern (PAMP) expression

  • Determine whether nuoK function affects host immune recognition

  • Explore potential of nuoK-derived peptides as vaccine components

These forward-looking research directions promise to significantly advance our understanding of bacterial respiratory complexes in pathogenesis and potentially lead to new therapeutic approaches.

What are the key considerations for designing gene expression systems for nuoK studies?

When designing expression systems for nuoK studies, researchers should implement these methodological considerations:

• Promoter Selection:

  • For physiological studies: Use native promoter to maintain natural expression levels

  • For biochemical characterization: Consider inducible promoters (e.g., PBAD, Ptet) for controlled expression

  • For infection models: Select promoters functional in the intracellular environment

• Affinity Tag Placement:

  • Position tags at the N-terminus to minimize interference with membrane insertion

  • Include a flexible linker (e.g., GGGGS) between the tag and protein

  • Verify that tagged constructs maintain wild-type function

• Codon Optimization:

  • Analyze the codon usage bias when expressing in heterologous systems

  • Avoid rare codons that might cause translational pausing

  • Maintain native codons at critical positions that might affect folding kinetics

• Vector Selection:

  • Choose low-copy vectors for membrane proteins to prevent overexpression toxicity

  • Ensure plasmid stability during infection experiments without antibiotic selection

  • Consider chromosomal integration for long-term infection studies

• Regulation of Expression:

  • Implement tight regulatory systems to prevent leaky expression

  • Include repressor elements when working with potentially toxic membrane proteins

  • Design expression systems compatible with in vivo infection conditions

These design principles ensure that nuoK expression accurately reflects natural conditions while providing the flexibility needed for diverse experimental applications.

How should researchers approach troubleshooting when recombinant nuoK protein aggregates during purification?

When encountering nuoK protein aggregation during purification, implement this systematic troubleshooting methodology:

• Detergent Optimization:

  • Test a panel of detergents with varied micelle sizes and chemical properties

  • Start with mild detergents (DDM, LMNG) before trying harsher options

  • Consider detergent mixtures that mimic natural membrane environments

  • Optimize detergent concentration based on critical micelle concentration (CMC)

• Buffer Condition Refinement:

  • Systematically test pH ranges from 6.5-8.5 in 0.5 unit increments

  • Evaluate different salt concentrations (100-500 mM NaCl)

  • Add stabilizing agents such as glycerol (5-20%) or specific lipids

  • Include reducing agents (1-5 mM DTT or TCEP) if disulfide formation is suspected

• Expression Condition Modification:

  • Reduce expression temperature to 16-20°C

  • Decrease inducer concentration to slow expression rate

  • Co-express with molecular chaperones (GroEL/ES, DnaK)

  • Test different E. coli host strains optimized for membrane proteins

• Purification Protocol Adjustments:

  • Implement on-column refolding procedures during affinity purification

  • Use step gradients rather than linear gradients for gentle elution

  • Add lipids or amphipols during purification to stabilize native structure

  • Consider native purification of the entire respiratory complex

• Advanced Solubilization Strategies:

  • Try nanodiscs or styrene-maleic acid lipid particles (SMALPs) for detergent-free purification

  • Implement high-throughput screening of condition combinations

  • Consider fusion with solubility-enhancing partners (MBP, SUMO)

This methodical approach addresses the common challenges of membrane protein purification and significantly increases the likelihood of obtaining stable, functional nuoK protein for downstream applications.