Recombinant Salmonella paratyphi C p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella paratyphi C p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Recombinant Salmonella paratyphi C p-hydroxybenzoic acid efflux pump subunit AaeA (AaeA) is a protein component of an efflux pump found in Salmonella paratyphi C . Efflux pumps are crucial in bacterial multidrug resistance, as they actively transport drugs and other toxic compounds out of the cell, preventing them from reaching their intracellular targets . AaeA, specifically, is involved in the efflux of p-hydroxybenzoic acid .

Protein Information

AaeA is a subunit of an efflux pump in Salmonella paratyphi C, with the gene name aaeA . It is also referred to as pHBA efflux pump protein A . The recombinant form of the protein is produced in E. coli and tagged with histidine (His) to facilitate purification .

Table 1: Properties of Recombinant AaeA Protein

PropertyDescription
SourceE. coli expression system
TagN-terminal His tag
PurityGreater than or equal to 85% as determined by SDS-PAGE
StorageStore at -20°C/-80°C
Shelf life (liquid)6 months at -20°C/-80°C
Shelf life (lyophilized)12 months at -20°C/-80°C
Uniprot No.C0PZR0

Function and Role in Resistance

Efflux pumps are significant contributors to multidrug resistance in bacteria . They function by expelling antimicrobials and other toxic substances, reducing their intracellular concentration . The AaeA subunit is part of a pump that specifically targets p-hydroxybenzoic acid, a compound that can be toxic to the cell if accumulated .

Efflux Pumps and Virulence

Beyond antibiotic resistance, efflux pumps play a role in the virulence of pathogens . For example, the AcrAB-TolC system in Escherichia coli is involved in multidrug resistance and the regulation of virulence . This system can expel toxic bile salts, aiding the survival of E. coli in the intestine . Similar functions have been observed in other species, including Pseudomonas aeruginosa, Neisseria gonorrhoeae, and Salmonella Typhimurium . In Salmonella Typhimurium, AcrB mutants show reduced adhesion and invasion capabilities in human intestinal epithelial cells and macrophages .

Regulation of Efflux Pumps

The expression and activity of efflux pumps are regulated by various factors . RamA, for instance, controls the Salmonella AcrAB-TolC multidrug efflux system in response to environmental signals . Conditioned medium from E. coli can induce several Salmonella multidrug efflux pumps, including acrAB and tolC, via the RamA regulator .

Methods to Study Efflux Pumps

Several methods are used to study efflux pumps, including:

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with additional charges; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; SPC_3435; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links

KEGG: sei:SPC_3435

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does AaeA fit into the broader context of Salmonella efflux pump systems?

The AaeA protein represents one component of the diverse efflux pump systems found in Salmonella species. While extensive research has been conducted on the AcrB efflux pump in Salmonella Typhimurium, which plays a crucial role in multidrug resistance by exporting antimicrobials, the AaeA protein in S. paratyphi C specifically contributes to p-hydroxybenzoic acid efflux .

What is the optimal protocol for expression and purification of recombinant AaeA protein?

The recombinant full-length Salmonella paratyphi C AaeA protein can be effectively expressed in E. coli expression systems with an N-terminal His-tag for purification purposes. A standard protocol includes:

  • Cloning: Insert the full-length aaeA gene (encoding amino acids 1-310) into an appropriate expression vector with an N-terminal His-tag.

  • Transformation: Transform the construct into a compatible E. coli strain.

  • Expression: Induce protein expression under optimized conditions.

  • Purification: Perform affinity chromatography using His-tag binding resins.

  • Quality Control: Confirm purity (>90%) by SDS-PAGE analysis.

  • Lyophilization: Prepare the purified protein in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 for lyophilization.

  • Storage: Store the lyophilized powder at -20°C/-80°C until use .

For reconstitution, the lyophilized protein should be centrifuged briefly before opening and reconstituted in deionized sterile water to 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 5-50% (50% recommended) is advised for long-term storage at -20°C/-80°C with aliquoting to avoid repeated freeze-thaw cycles .

How can researchers assess the functional activity of recombinant AaeA protein in vitro?

Assessing the functional activity of recombinant AaeA protein requires examining its ability to participate in p-hydroxybenzoic acid efflux. Recommended methodological approaches include:

MethodMeasurement ParameterExperimental Setup
Fluorescent substrate accumulation assayIntracellular accumulation of fluorescent p-hydroxybenzoic acid derivativesCompare accumulation in systems with and without functional AaeA
Membrane vesicle transport assayATP-dependent transport of labeled p-hydroxybenzoic acidPrepare inside-out membrane vesicles expressing AaeA
Isothermal titration calorimetry (ITC)Binding affinity to p-hydroxybenzoic acidMeasure thermodynamic parameters of binding
Antimicrobial susceptibility testingMIC determination for p-hydroxybenzoic acidCompare strains with and without functional AaeA

The functional assessment should include appropriate controls such as AaeA mutants with altered function or structurally related efflux pump proteins like those found in the AcrB system of S. Typhimurium .

How does the structure-function relationship of AaeA compare with other efflux pump components in pathogenic Salmonella species?

The AaeA protein represents a distinct efflux pump component compared to the extensively studied AcrB multidrug resistance efflux pump. Structural and functional analyses reveal several key points of comparison:

Understanding these comparative aspects provides insight into the specialized roles of different efflux systems in pathogenic Salmonella and their contribution to virulence and survival mechanisms.

What are the implications of AaeA function for Salmonella paratyphi C pathogenesis and vaccine development?

The AaeA efflux pump subunit may have significant implications for S. paratyphi C pathogenesis and could represent a potential target for vaccine development strategies. Several key considerations include:

The development of effective vaccines against paratyphoid fever A, caused by S. Paratyphi A, remains an urgent need as current typhoid vaccines lack cross-protection against paratyphoid strains. Similar considerations would apply to S. paratyphi C, with potential exploration of AaeA as part of a comprehensive vaccine development strategy .

How does the AaeA efflux system in S. paratyphi C compare with similar systems in other Salmonella serovars and enteric pathogens?

The AaeA p-hydroxybenzoic acid efflux pump subunit in S. paratyphi C represents one of several efflux systems that contribute to bacterial defense mechanisms. Comparative analysis with other systems reveals:

Efflux SystemOrganismSubstrate SpecificityStructural OrganizationRole in Pathogenesis
AaeAS. paratyphi Cp-hydroxybenzoic acidComponent of specific efflux systemUnder investigation
AcrBS. TyphimuriumMultiple drugs, fatty acids/alcohols, acylcarnitinesTripartite RND systemInfluences virulence, quorum sensing, metabolism
AcrBE. coliMultiple drugs, fatty acids/alcoholsTripartite RND systemSimilar to S. Typhimurium but with distinct substrate profiles
Other RND pumpsVarious Salmonella serovarsVariable specificitySimilar tripartite organizationVariable contributions to virulence

This comparative understanding is crucial for researchers developing targeted interventions against specific Salmonella serovars or seeking to understand the evolutionary adaptations of different efflux systems across enteric pathogens .

What genetic and regulatory factors control the expression of AaeA in S. paratyphi C, and how do these compare with other efflux systems?

Understanding the genetic context and regulatory mechanisms controlling AaeA expression provides insight into its physiological roles and potential for manipulation. Key considerations include:

  • Genetic Organization: The aaeA gene (also designated SPC_3435) encodes the p-hydroxybenzoic acid efflux pump subunit in S. paratyphi C. Investigation of its genomic context and potential operon structure would reveal co-regulated genes.

  • Regulatory Mechanisms: While specific regulatory mechanisms for AaeA in S. paratyphi C require further characterization, research on other efflux systems like AcrB in S. Typhimurium has revealed complex regulation involving:

    • Global transcriptional regulators responding to environmental stresses

    • Quorum sensing systems influencing expression levels

    • Metabolic state-dependent regulation

  • Comparative Analysis: Researchers should examine whether AaeA expression shares regulatory features with other efflux systems or possesses unique control mechanisms that reflect its specialized function .

This understanding enables strategic approaches to modulate efflux pump expression for research or therapeutic purposes.

What are common challenges in working with recombinant AaeA protein, and how can they be addressed?

Researchers working with recombinant AaeA protein may encounter several technical challenges that can be addressed through optimized protocols:

  • Protein Solubility and Stability:

    • Challenge: As a membrane protein component, AaeA may present solubility issues.

    • Solution: Optimize buffer conditions (detergents, pH, salt concentration) and consider adding stabilizing agents like trehalose (6% as used in commercial preparations) .

  • Functional Reconstitution:

    • Challenge: Maintaining functional activity after purification.

    • Solution: Careful handling to avoid freeze-thaw cycles, proper reconstitution in appropriate buffers, and addition of glycerol (5-50%) for long-term storage .

  • Structural Analysis:

    • Challenge: Obtaining structural data for membrane protein components.

    • Solution: Consider complementary approaches including crystallography, cryo-EM, and in silico structural prediction methods.

  • Functional Assays:

    • Challenge: Developing specific assays for p-hydroxybenzoic acid efflux activity.

    • Solution: Adapt established protocols for similar efflux pumps, incorporating appropriate controls and substrate specificity tests.

Each challenge requires systematic troubleshooting and optimization based on the specific research objectives.

How can researchers effectively design experiments to elucidate the role of AaeA in antibiotic resistance mechanisms of S. paratyphi C?

To investigate AaeA's role in antibiotic resistance mechanisms, researchers should consider a multi-faceted experimental approach:

  • Gene Deletion/Mutation Studies:

    • Generate aaeA knockout mutants in S. paratyphi C

    • Create point mutations at conserved residues to identify essential functional domains

    • Develop complementation strains to verify phenotypes

  • Expression Analysis:

    • Measure aaeA expression under various antibiotic stresses

    • Compare expression patterns with other efflux pump genes

    • Identify conditions that specifically induce aaeA expression

  • Substrate Profiling:

    • Conduct comprehensive screening to identify the full substrate range

    • Compare with substrate profiles of other efflux pumps like AcrB

    • Identify specific antibiotics or compounds affected by AaeA function

  • Structural-Functional Studies:

    • Map critical residues for substrate recognition and transport

    • Identify potential inhibitor binding sites

    • Compare with structural data from related efflux pumps

  • Infection Models:

    • Assess the contribution of AaeA to S. paratyphi C virulence in relevant infection models

    • Evaluate the impact of aaeA deletion on bacterial survival within host environments

Drawing from research on the AcrB efflux pump in S. Typhimurium, which demonstrated roles beyond antibiotic resistance in bacterial physiology and pathogenesis, researchers should expand their investigations to understand similar multifunctional aspects of the AaeA protein .

What emerging technologies and approaches could advance our understanding of AaeA function in S. paratyphi C?

Cutting-edge technologies offer new opportunities to understand AaeA function in greater depth:

  • CRISPR-Cas9 Genome Editing:

    • Precise modification of aaeA sequences to study structure-function relationships

    • Creation of regulated expression systems to control AaeA levels

    • Introduction of reporter fusions to monitor expression in real-time

  • Single-Cell Analysis:

    • Examination of heterogeneity in AaeA expression within bacterial populations

    • Correlation with antibiotic resistance phenotypes at the single-cell level

    • Tracking of dynamic responses to environmental changes

  • Advanced Imaging:

    • Super-resolution microscopy to visualize AaeA localization within the bacterial membrane

    • FRET-based approaches to study protein-protein interactions

    • Live-cell imaging to track efflux dynamics

  • Systems Biology Approaches:

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Network analysis to position AaeA within broader defense mechanisms

    • Computational modeling of efflux dynamics

These approaches, when combined with traditional biochemical and genetic methods, will provide comprehensive insights into the multifaceted roles of AaeA in S. paratyphi C biology and pathogenesis .

How might understanding AaeA function contribute to novel antimicrobial strategies against S. paratyphi C infections?

Elucidating AaeA function opens several potential avenues for antimicrobial development:

  • Efflux Pump Inhibitors (EPIs):

    • Development of specific inhibitors targeting AaeA function

    • Combination therapy approaches using EPIs with conventional antibiotics

    • Structure-based design of inhibitors based on substrate binding sites

  • Attenuated Vaccine Candidates:

    • Creation of S. paratyphi C strains with modified efflux capacity as potential vaccine candidates

    • Assessment of immunogenicity and protective efficacy

    • Comparison with other attenuation strategies like the guaBA and clpX deletions used in S. Paratyphi A vaccine development

  • Diagnostic Applications:

    • Development of assays detecting AaeA expression as markers of antibiotic resistance

    • Identification of AaeA-specific antibodies in infected individuals

    • Rapid detection methods for resistant S. paratyphi C strains

  • Combination Therapy Strategies:

    • Identification of antibiotic classes most affected by AaeA-mediated efflux

    • Design of treatment regimens that circumvent or exploit efflux mechanisms

    • Evaluation of synergistic drug combinations targeting multiple bacterial defense systems

These approaches align with the urgent need for new strategies against enteric fever, as highlighted by the increasing proportion of paratyphoid fever cases and the limited cross-protection offered by current typhoid vaccines .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.