Recombinant Salmonella paratyphi C Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Biological Role in Salmonella Pathogenesis

YciB contributes to maintaining cell envelope integrity, a critical factor for bacterial survival under host-induced stress. Genomic analyses of Salmonella Paratyphi C reveal that this pathogen shares 89.78% gene similarity with S. Typhi but exhibits distinct adaptations, including plasmid degradation and pseudogene accumulation . YciB’s interaction with membrane components may facilitate these adaptive processes.

  • Functional Insights:

    • YciB homologs in S. Typhimurium (e.g., YciF) exhibit ferroxidase activity, mitigating oxidative stress by sequestering excess iron . While direct evidence for YciB’s enzymatic function is pending, structural similarities suggest analogous roles in metal homeostasis .

    • Comparative genomics highlight convergent evolution among typhoid-associated Salmonella, where proteins like YciB may drive host-specific adaptations .

Table 2: Genomic Context of yciB in Salmonella Paratyphi C

Genome FeatureChromosomePlasmid (pSPCV)
Size4,833,080 bp55,414 bp
G+C Content52.2%52.8%
Pseudogenes1493
yciB LocationChromosomal (STM1735)Absent

Future Directions

  • Structural Studies: High-resolution crystallography to elucidate metal-binding sites and oligomerization mechanisms.

  • Functional Assays: Validate ferroxidase or septation activity using knockout models.

  • Therapeutic Exploration: Assess YciB’s immunogenicity for vaccine development, akin to O-antigen conjugates .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; SPC_1994; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLN LAWALFFIACGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: sei:SPC_1994

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is yciB and what is its basic membrane topology?

YciB (probable intracellular septation protein A) is an inner membrane protein with five transmembrane domains, as confirmed through membrane topology studies. In Escherichia coli, the protein spans the inner membrane and plays a critical role in maintaining cell envelope integrity. The amino acid sequence of yciB (179 amino acids in E. coli O81) suggests a highly hydrophobic protein with multiple membrane-spanning regions, consistent with its localization and function .

What are the known cellular functions of yciB in enteric bacteria?

YciB participates in several essential cellular processes including cell elongation and cell division through protein-protein interactions with respective complexes. Research using bacterial two-hybrid systems has demonstrated that yciB interacts with various proteins involved in these processes. Additionally, deletion studies have shown that yciB-deficient mutants exhibit increased susceptibility to low osmolarity environments, suggesting its involvement in maintaining membrane integrity under osmotic stress conditions .

How conserved is yciB between Salmonella paratyphi C and E. coli?

While the search results don't provide direct sequence comparison between S. paratyphi C and E. coli yciB, comparative genomic analyses show considerable conservation of inner membrane proteins across enteric bacteria. The functional characterization of yciB in E. coli provides a foundation for understanding its role in Salmonella species. Given the genetic relationship between these enteric bacteria, the core functional domains of yciB are likely preserved, though species-specific variations may exist related to host adaptation patterns .

What expression systems are most effective for recombinant yciB production?

E. coli-based expression systems have proven effective for recombinant yciB production, as evidenced by the successful expression of His-tagged full-length yciB. When expressing membrane proteins like yciB, it's critical to consider expression conditions that minimize toxicity while maximizing protein yield. For example, commercial recombinant yciB is produced with N-terminal His-tags in E. coli expression systems, demonstrating the feasibility of this approach .

What purification strategies yield highest purity for recombinant yciB?

Affinity chromatography using His-tag purification methods is the primary approach for obtaining high-purity yciB. According to available data, purification protocols can achieve >90% purity as determined by SDS-PAGE. The purified protein is typically prepared as a lyophilized powder in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability. For downstream applications, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with 5-50% glycerol added for long-term storage stability .

What reconstitution methods preserve native conformation of yciB?

As a membrane protein, yciB requires careful handling during reconstitution to maintain its native conformation. The recommended approach involves brief centrifugation of the lyophilized protein before opening, followed by reconstitution in deionized sterile water. Addition of glycerol (typically 50% final concentration) helps maintain protein stability during storage at -20°C/-80°C. Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for no more than one week to preserve functional integrity .

What assays can detect yciB interactions with cell division proteins?

Bacterial two-hybrid systems have successfully demonstrated yciB interactions with cell division proteins. This technique was instrumental in identifying that yciB interacts with various proteins involved in cell elongation and cell division complexes. For researchers investigating novel interaction partners, pull-down assays using recombinant His-tagged yciB combined with mass spectrometry could provide comprehensive identification of interacting proteins. Co-immunoprecipitation experiments with antibodies against known division proteins can also validate specific interactions in vivo .

How can researchers measure membrane fluidity changes associated with yciB function?

Generalized polarization (GP) assays using the fluorescent dye Laurdan provide quantitative measurements of membrane fluidity changes associated with yciB function. This methodology has been successfully employed to demonstrate that yciB dcrB double mutants exhibit increased lipid ordering (decreased fluidity) compared to wild-type cells. The GP values are inversely correlated with membrane fluidity, making this a valuable technique for assessing how yciB mutations impact membrane physical properties. Control experiments using known membrane fluidizers like benzyl alcohol can validate the assay's sensitivity and reliability .

What approaches effectively measure yciB's impact on lipoprotein processing?

Analysis of lipoprotein processing defects can be performed through a combination of:

  • Western blot analysis to detect different forms of lipoproteins (e.g., Lpp)

  • Subcellular fractionation to determine lipoprotein localization

  • Monitoring expression of stress response systems (Cpx and Rcs)

  • Complementation studies with known lipoprotein processing enzymes (e.g., Lgt)

These approaches have revealed that yciB deficiency, particularly in combination with dcrB deletion, leads to inefficient lipid modification at the first step of lipoprotein maturation catalyzed by Lgt. This results in mislocalization of outer membrane lipoproteins to the inner membrane .

What genetic approaches can isolate suppressor mutations of yciB deletion phenotypes?

Suppressor mutation analysis has proven valuable in understanding yciB function, particularly in the context of yciB dcrB synthetic lethality. Several effective approaches include:

  • Deletion of lpp (outer membrane lipoprotein)

  • Removal of peptidoglycan-lipoprotein linkages

  • Overexpression of Lgt (catalyzes first step in lipoprotein maturation)

  • Deletion of skp (increases σE activity and enhances MicL sRNA amounts)

These genetic approaches have revealed that yciB dcrB synthetic lethality primarily results from inappropriate peptidoglycan-inner membrane linkages mediated by mislocalized Lpp, highlighting critical pathways for suppression analysis .

How can researchers distinguish between direct and indirect effects of yciB deletion?

Distinguishing direct from indirect effects of yciB deletion requires a multi-faceted approach:

  • Comparative analysis of single (yciB) and double (yciB dcrB) mutants

  • Complementation studies with wild-type or mutant yciB variants

  • Analysis of stress response activation patterns

  • Temporal studies of phenotypic manifestations

For example, research has shown that while Cpx pathway activation occurs in both yciB single and yciB dcrB double mutants, Rcs activation and Lpp mislocalization are predominantly observed in the double mutant. This suggests that some phenotypes (e.g., Cpx activation) are direct consequences of yciB deletion, while others (e.g., lipoprotein maturation defects) emerge only when both yciB and dcrB are absent .

What growth conditions exacerbate yciB-related phenotypes?

Low osmolarity and low temperature conditions significantly exacerbate yciB-related phenotypes. YciB deletion mutants show increased susceptibility to low osmolarity environments, suggesting its role in maintaining cell envelope integrity under these conditions. Additionally, dcrB null mutants are not viable when grown at low temperatures, conditions known to affect membrane fluidity. These observations indicate that yciB function becomes particularly critical under environmental stresses that impact membrane physical properties and homeostasis .

How does yciB function differ between Salmonella paratyphi C and other Salmonella serovars?

While specific comparative data on yciB function across Salmonella serovars is limited in the provided research, genomic studies indicate that S. paratyphi C shares greater genetic similarity with S. choleraesuis than with S. typhi or S. paratyphi A. Of the 4,640 genes identified in S. paratyphi C, 4,346 are shared with S. choleraesuis (primarily a swine pathogen), while only 4,008 are shared with the human-adapted S. typhi. This suggests that yciB function and regulation may be more similar between S. paratyphi C and S. choleraesuis, reflecting their closer evolutionary relationship despite different host adaptation patterns .

What evolutionary patterns suggest functional divergence of yciB in host-adapted pathogens?

Evolutionary analysis reveals that typhoid-causing Salmonella serovars (including S. paratyphi C) evolved through convergent rather than divergent evolution. The specific selective pressures during adaptation to human hosts likely influenced the evolution of membrane proteins like yciB. Comparative genomic analysis shows that S. paratyphi C diverged from a common ancestor with S. choleraesuis through the accumulation of genomic novelty during human adaptation. This is reflected in differential nucleotide substitutions and distinct sets of pseudogenes between these closely related lineages. The greater number of non-synonymous (dN) than synonymous (dS) substitutions between S. paratyphi C and S. choleraesuis suggests rapid selection for amino acid changes that facilitated host adaptation .

How can yciB be used as a target for developing novel antimicrobials?

YciB represents a promising antimicrobial target due to several favorable characteristics:

  • Essential role in maintaining cell envelope integrity, particularly under stress conditions

  • Synergistic relationship with other membrane proteins (e.g., DcrB)

  • No homologs in mammalian cells, reducing off-target effects

  • Involvement in fundamental cellular processes like cell division

Researchers could develop small molecule inhibitors that disrupt yciB's interactions with cell division proteins or alter its membrane topology. Alternatively, peptide-based approaches targeting the transmembrane domains could disrupt its function. The synthetic lethality observed between yciB and dcrB also suggests that combination therapies targeting both proteins could be particularly effective against Salmonella infections .

What role might yciB play in bacterial stress response and antimicrobial resistance?

YciB likely plays significant roles in bacterial stress response and potentially antimicrobial resistance through:

  • Maintenance of cell envelope integrity under osmotic stress

  • Involvement in lipoprotein maturation pathways

  • Impact on membrane fluidity and lipid homeostasis

  • Activation of envelope stress response systems (Cpx, Rcs)

The altered membrane fluidity observed in yciB mutants might affect the uptake or efflux of antimicrobial compounds. Additionally, defects in lipoprotein processing could impact the assembly of efflux pumps or other resistance mechanisms that depend on properly localized lipoproteins. Further research specifically targeting the relationship between yciB function and antimicrobial susceptibility profiles could reveal important mechanistic insights .

How can structural biology approaches enhance understanding of yciB function?

Advanced structural biology approaches would significantly enhance understanding of yciB function:

  • Cryo-electron microscopy to determine the high-resolution structure of yciB within the membrane

  • Molecular dynamics simulations to model how yciB interacts with lipids and alters membrane properties

  • NMR studies of isolated domains to identify interaction surfaces

  • Cross-linking mass spectrometry to map the interactome of yciB in vivo

These approaches could reveal how the five transmembrane domains are arranged, identify key residues involved in protein-protein interactions, and elucidate the mechanism by which yciB influences membrane fluidity and lipoprotein processing. Understanding the structural basis of yciB function would also facilitate rational design of inhibitors targeting this protein .

What challenges arise when expressing recombinant membrane proteins like yciB?

Expression of membrane proteins like yciB presents several significant challenges:

  • Toxicity to host cells due to membrane insertion disrupting normal function

  • Protein misfolding and aggregation during overexpression

  • Low yields compared to soluble proteins

  • Difficulties in maintaining native conformation during purification

Researchers can address these challenges by:

  • Using tightly controlled inducible expression systems

  • Optimizing growth temperatures (typically lower than for soluble proteins)

  • Including membrane-mimicking detergents during cell lysis and purification

  • Exploring fusion partners that enhance solubility

  • Attempting expression in cell-free systems with supplied lipids or detergents

How can researchers overcome difficulties in phenotypic analysis of yciB mutants?

The complex and potentially redundant functions of yciB create challenges in phenotypic analysis that can be addressed through:

  • Creating conditional mutants (temperature-sensitive or inducible depletion)

  • Combining mutations in synthetic lethal screens to reveal functional relationships

  • Using stress conditions (osmotic, temperature) that exacerbate phenotypes

  • Employing sensitive readouts for envelope stress (reporter fusions to stress-responsive promoters)

  • Conducting temporal analyses following yciB depletion to distinguish primary from secondary effects

The synthetic lethality observed between yciB and dcrB illustrates how combining mutations can reveal functional relationships that are not apparent in single mutants, highlighting the value of genetic interaction screens .

What are the most common pitfalls in interpreting yciB functional studies?

When interpreting yciB functional studies, researchers should be aware of several common pitfalls:

  • Attributing indirect effects to direct yciB function (e.g., stress responses triggered by envelope defects)

  • Overlooking strain-specific variations in phenotypes

  • Failing to account for growth conditions that might mask or exacerbate phenotypes

  • Misinterpreting complementation studies if expression levels differ from native conditions

  • Overlooking compensatory mechanisms that mask phenotypes in single mutants

For example, research has shown that while Cpx activation occurs in yciB single mutants, more severe phenotypes like lipoprotein maturation defects are only observed in yciB dcrB double mutants. This illustrates how single-gene studies might miss important functional aspects revealed through synthetic genetic approaches .

What emerging technologies could advance understanding of yciB dynamics in living cells?

Several emerging technologies hold promise for advancing understanding of yciB dynamics in living cells:

  • Super-resolution microscopy techniques (PALM, STORM) to visualize yciB localization and dynamics during cell division

  • CRISPR interference (CRISPRi) for precise temporal control of yciB expression

  • Proximity labeling approaches (BioID, APEX) to map the dynamic interactome of yciB

  • Single-molecule tracking to monitor yciB diffusion and interactions in the membrane

  • Microfluidics combined with time-lapse microscopy to analyze yciB function under changing environmental conditions

These approaches would provide unprecedented insights into how yciB localizes, interacts with other proteins, and responds to environmental changes in real-time within living bacterial cells .

How might systems biology approaches integrate yciB function into broader cellular networks?

Systems biology approaches could integrate yciB function into broader cellular networks through:

  • Network analysis of genetic interactions to position yciB within functional pathways

  • Multi-omics integration (transcriptomics, proteomics, lipidomics) to understand the global impact of yciB perturbation

  • Flux balance analysis to model how yciB affects cell envelope biogenesis

  • Computational modeling of membrane protein interactions and dynamics

These integrative approaches could reveal how yciB functions within the complex network of proteins involved in cell envelope synthesis, cell division, and stress response pathways. Understanding these relationships would provide a more comprehensive view of how yciB contributes to cellular homeostasis and adaptability .

What potential biotechnological applications might exploit recombinant yciB properties?

Beyond basic research, recombinant yciB might find applications in several biotechnological contexts:

  • Development of bacterial surface display systems leveraging yciB's membrane integration properties

  • Creation of attenuated live vaccine strains using controlled yciB expression

  • Engineering membrane vesicles with modified yciB for drug delivery applications

  • Development of biosensors for detecting envelope stress or antimicrobial compounds

  • Protein engineering to create chimeric membrane proteins with novel functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.