Recombinant Salmonella paratyphi C Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence and Domains

The recombinant protein spans 291 amino acids (Uniprot: C0PXJ0) with a calculated molecular mass of ~31.6 kDa . Key structural features include:

  • Transmembrane topology: Predicted membrane embedding via seven transmembrane segments, with an N-terminal periplasmic orientation and C-terminal cytoplasmic orientation .

  • Conserved motifs: A signature motif (H-103-GGLIG-108) critical for catalytic activity, shared across Gram-negative and Gram-positive bacteria .

Table 2: Genomic Features of S. paratyphi C (Strain RKS4594)

FeatureDetailsSource
Chromosome Size4,833,080 bp
Plasmid Size55,414 bp (pSPCV, virulence-related)
Core Genome3,691 genes shared with other Salmonella serovars
Unique RegionsSPI7, pefABCD operon, and spv operon in the plasmid

Structure-Function Insights

  • Conserved residues: Mutations in H-103-GGLIG-108 (e.g., G104S in E. coli) render the enzyme temperature-sensitive .

  • Membrane topology: SCAM (substituted cysteine accessibility method) studies confirm seven transmembrane segments .

Experimental Use

  • ELISA kits: Recombinant lgt is used as an antigen in immunoassays to study bacterial lipoprotein processing .

  • Pathogenicity studies: Investigating membrane protein biogenesis in Salmonella and related pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your desired format in the order notes for our preparation.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
lgt; SPC_3060; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPDFRFAMLFPGSRAEDIALLPSH PQWQPIFDTYGVLPRHPSQLYELALEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: sei:SPC_3060

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional significance of Prolipoprotein diacylglyceryl transferase in Salmonella?

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme that catalyzes the first step in the biogenesis of bacterial lipoproteins, which are essential for maintaining outer membrane integrity in Gram-negative bacteria like Salmonella. The enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox motif of prolipoproteins via a thioether bond formation. This modification is crucial for proper lipoprotein anchoring to the membrane and subsequent processing steps in the lipoprotein maturation pathway. In Salmonella species, including S. paratyphi C, this enzyme likely shares significant functional similarities with Lgt from other enterobacteria such as E. coli, with which it would share sequence homology and catalytic mechanisms .

The importance of Lgt becomes evident when examining the consequences of its depletion or inhibition. Studies in related bacteria have demonstrated that Lgt depletion leads to severe outer membrane permeabilization, increased sensitivity to antibiotics, and enhanced susceptibility to serum killing, ultimately compromising bacterial viability and virulence. These phenotypes likely extend to S. paratyphi C as well, making recombinant Lgt from this pathogen a significant subject for antimicrobial research and basic bacterial physiology investigations .

How does S. paratyphi C Lgt compare to Lgt from other bacterial species?

When comparing Lgt from S. paratyphi C to other bacterial species, researchers should consider both sequence conservation and functional characteristics. Studies of Lgt from phylogenetically distant bacteria reveal interesting patterns of conservation and divergence. For example, Staphylococcus aureus Lgt shows 24% identity and 47% similarity with E. coli, Salmonella typhimurium, and Haemophilus influenzae Lgt enzymes, suggesting a relatively conserved functional core despite sequence variations .

Based on established patterns among enterobacteria, S. paratyphi C Lgt would likely share higher sequence identity with Lgt from other Salmonella species and E. coli (potentially >80% identity) than with more distant bacteria. Despite sequence differences, important characteristics such as hydropathy profiles and isoelectric points tend to remain similar across species, indicating conserved structural features that support enzymatic function. For instance, S. aureus Lgt, while 12 amino acids shorter than E. coli Lgt, maintains a similar hydropathic profile and predicted pI (10.4), suggesting that these biophysical properties are important for function regardless of the bacterial source .

What expression systems are most effective for producing recombinant S. paratyphi C Lgt?

The expression of recombinant Lgt from S. paratyphi C presents significant challenges due to its multiple transmembrane domains and membrane-associated enzymatic activity. Several expression systems can be considered, each with distinct advantages for different research applications. E. coli-based expression systems often serve as the first choice due to their ease of manipulation, rapid growth, and high protein yields. When using E. coli, researchers should consider complementation approaches, similar to those employed for S. aureus Lgt, where the recombinant gene was expressed in an E. coli lgt mutant strain (such as SK634) to restore Lgt activity .

For more structurally accurate protein production, homologous expression in attenuated Salmonella strains may prove beneficial, particularly when studying protein-protein interactions or performing in vivo functional assays. Cell-free expression systems represent another alternative for producing potentially toxic membrane proteins, though yields may be lower. Regardless of the chosen system, optimization of codon usage, temperature control (typically lowered to 16-25°C during induction), and inclusion of appropriate detergents during purification are critical factors for successful recombinant Lgt production. When expressing the enzyme for functional studies, researchers should verify its activity using in vitro assays measuring glycerol phosphate release from phosphatidylglycerol in the presence of appropriate peptide substrates containing the conserved cysteine residue .

How can researchers develop selective inhibitors against S. paratyphi C Lgt for antimicrobial applications?

Developing selective inhibitors against S. paratyphi C Lgt requires a methodical approach combining structural insights, biochemical screening, and medicinal chemistry optimization. Researchers should first establish a robust biochemical assay system capable of detecting Lgt activity with high sensitivity. One effective approach is to measure the release of glycerol phosphate, a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to peptide substrates. This can be achieved through coupled enzyme assays involving luciferase reactions that generate luminescent signals proportional to enzyme activity .

For initial screening, researchers should design peptide substrates derived from known Salmonella lipoproteins (such as Pal-IAAC, where C is the conserved cysteine modified by Lgt) and incorporate appropriate controls, including mutant peptides where the conserved cysteine is replaced with alanine. High-throughput screening campaigns can then be implemented to identify compounds that inhibit the biochemical activity of recombinant S. paratyphi C Lgt. Promising hits should demonstrate potent IC50 values (ideally sub-micromolar, similar to the G9066, G2823, and G2824 compounds identified against E. coli Lgt with IC50 values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively) and be validated through orthogonal assays to confirm their mechanism of action .

Structure-activity relationship studies should follow to optimize lead compounds for increased potency, selectivity, and pharmacokinetic properties. The unique advantage of targeting Lgt, as opposed to other lipoprotein biosynthesis enzymes, is that resistance mechanisms involving deletion of major outer membrane lipoproteins (lpp) do not confer protection against Lgt inhibitors, potentially making this a more robust antimicrobial target .

What experimental approaches can resolve contradictions in Lgt essentiality across different Salmonella strains?

Resolving contradictions regarding Lgt essentiality across different Salmonella strains requires sophisticated genetic and phenotypic analyses. Researchers should implement inducible gene deletion systems to precisely control lgt expression levels, similar to approaches used in E. coli studies. This method allows for the observation of phenotypic consequences when Lgt levels are gradually depleted, providing insights into strain-specific differences in essentiality thresholds .

The conditional deletion approach can be accomplished using genetic tools such as arabinose-inducible promoters controlling lgt expression. In this system, the native lgt gene is deleted from the chromosome, while a complementing copy is provided on a plasmid under the control of an inducible promoter. By modulating inducer concentrations, researchers can generate a gradient of Lgt expression levels and correlate these with various phenotypic readouts, including growth rates, membrane permeability (using dyes like propidium iodide), antibiotic sensitivity profiles, and lipoprotein processing patterns detected via Western blot analysis .

To address strain-specific differences, these experiments should be conducted in parallel with multiple S. paratyphi C isolates alongside other Salmonella strains reported to have differing Lgt essentiality. The analysis should include quantitative assessment of bacterial survival in various stress conditions (serum exposure, antibiotic challenge) and detailed examination of lipoprotein profiles using fractionation techniques that separate peptidoglycan-associated proteins (PAP) from non-PAP fractions. Additionally, comparative genomic and transcriptomic analyses should be performed to identify potential compensatory mechanisms that might explain differential essentiality of lgt across strains. These comprehensive approaches will help establish whether apparent contradictions in essentiality result from true biological differences or technical variations in experimental design and interpretation .

How does the substrate specificity of S. paratyphi C Lgt differ from other bacterial species?

Investigating the substrate specificity of S. paratyphi C Lgt compared to other bacterial species requires detailed biochemical characterization using multiple substrate types and conditions. Researchers should express and purify recombinant Lgt enzymes from S. paratyphi C and comparator species (such as E. coli, S. typhimurium, and more distant bacteria like S. aureus) using similar expression and purification protocols to ensure fair comparisons. The purified enzymes should then be subjected to comprehensive in vitro activity assays using a diverse panel of peptide substrates derived from various bacterial lipoproteins .

A methodical approach would include testing synthetic peptides containing the conserved lipobox motif (L-A/S-G/A-C) from different Salmonella lipoproteins, alongside homologous peptides from other bacterial species. Kinetic parameters (Km, kcat) should be determined for each substrate-enzyme combination using assays that measure either glycerol phosphate release or direct detection of diacylglyceryl-modified peptides through mass spectrometry or radioactive labeling. These experiments will reveal whether S. paratyphi C Lgt exhibits preference for certain lipobox sequences or structural features .

Additionally, researchers should investigate the phospholipid donor specificity by testing various phospholipids beyond phosphatidylglycerol. Thin-layer chromatography and mass spectrometry can be employed to analyze the incorporation efficiency of different diacylglyceryl donors. The pH-activity profile, temperature optima, and cation requirements should also be determined for each enzyme to identify potential species-specific adaptations. Finally, cross-complementation studies in lgt mutant strains from different bacterial species would provide in vivo evidence of functional conservation or specialization across evolutionary lineages .

What are the optimal purification strategies for obtaining active recombinant S. paratyphi C Lgt?

Purifying active recombinant S. paratyphi C Lgt presents significant challenges due to its nature as an integral membrane protein with multiple transmembrane domains. A systematic purification strategy should begin with optimized expression conditions that balance protein yield with proper folding and membrane integration. For recombinant S. paratyphi C Lgt, expression at reduced temperatures (16-20°C) with moderate inducer concentrations often yields better results than standard conditions .

The purification protocol should incorporate several critical steps, beginning with careful membrane isolation using differential centrifugation. Membrane fractions containing the overexpressed Lgt should be solubilized using appropriate detergents; mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin often preserve enzymatic activity better than harsher detergents like Triton X-100 or SDS. A detergent screening approach is recommended to identify the optimal solubilization conditions for S. paratyphi C Lgt specifically .

Following solubilization, affinity chromatography using tags such as polyhistidine or Strep-tag II provides efficient initial purification. For enhanced purity, researchers should implement additional purification steps including ion exchange chromatography and size exclusion chromatography. Throughout the purification process, it is essential to maintain a stable buffer environment containing the selected detergent at concentrations above its critical micelle concentration, appropriate pH (typically 7.0-8.0), and stabilizing agents such as glycerol (10-20%) and specific phospholipids that may enhance enzyme stability .

Activity assessment should be performed at each purification stage using the glycerol phosphate release assay with appropriate peptide substrates. The final purified enzyme preparation should be characterized for homogeneity using SDS-PAGE, Western blotting, and mass spectrometry, with activity confirmation through detailed kinetic analysis .

How can researchers design reliable in vitro activity assays for S. paratyphi C Lgt?

Designing reliable in vitro activity assays for S. paratyphi C Lgt requires careful consideration of substrate preparation, reaction conditions, and detection methods. A well-established approach measures the release of glycerol phosphate, which is a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to peptide substrates. Researchers should develop a coupled enzyme assay system where glycerol-3-phosphate (G3P) or glycerol-1-phosphate (G1P) is detected through subsequent enzymatic reactions, ultimately generating a measurable signal such as luminescence through luciferase activity .

The assay components should include purified recombinant S. paratyphi C Lgt, phosphatidylglycerol preparations (preferably including species with defined fatty acid compositions), and synthetic peptide substrates derived from Salmonella lipoproteins containing the conserved lipobox motif with the reactive cysteine residue. Control peptides where the cysteine is mutated to alanine should be included to confirm assay specificity. The reaction buffer should maintain physiologically relevant pH (approximately 7.4) and include appropriate concentrations of divalent cations (Mg²⁺ or Mn²⁺) that may enhance enzyme activity .

For quantitative analysis, researchers should establish standard curves using known concentrations of G3P or G1P and determine the linear range of the assay. Kinetic parameters (Km, Vmax) should be calculated using varying concentrations of both phosphatidylglycerol and peptide substrates. To ensure reproducibility, detailed attention must be paid to reaction temperature, incubation time, detergent type and concentration, and enzyme-to-substrate ratios. Alternative assay methods, such as thin-layer chromatography or mass spectrometry-based approaches that directly detect the diacylglyceryl-modified peptides, should be developed as orthogonal validation techniques .

What genetic tools are available for studying S. paratyphi C Lgt function in vivo?

Investigating S. paratyphi C Lgt function in vivo requires sophisticated genetic manipulation tools that enable controlled expression, deletion, or modification of the lgt gene within its native context. Researchers have several methodological options available, beginning with the construction of conditional knockout strains using inducible promoter systems. The arabinose-inducible araBAD promoter system has been successfully employed for this purpose in related bacteria, allowing for precise control of lgt expression levels through varying arabinose concentrations .

For targeted gene deletion or modification, lambda Red recombineering represents an efficient approach in Salmonella species. This technique facilitates the replacement of the native lgt gene with selectable markers or modified versions containing specific mutations. Alternatively, CRISPR-Cas9 systems adapted for Salmonella can achieve highly specific genomic edits with minimal off-target effects, enabling the introduction of point mutations that affect specific aspects of Lgt function without completely abolishing the protein .

Complementation studies using plasmid-expressed lgt variants are essential for verifying phenotypic observations and conducting structure-function analyses. These should include both homologous (S. paratyphi C) and heterologous (from other bacterial species) lgt genes to examine functional conservation. Reporter fusion constructs, where lgt is fused to fluorescent proteins or enzymatic reporters, can provide insights into expression patterns, subcellular localization, and protein-protein interactions .

Phenotypic characterization of these genetic constructs should involve comprehensive assessments of bacterial growth, membrane integrity (using dyes like propidium iodide), antibiotic sensitivity profiles, and detailed analysis of lipoprotein processing through Western blot analysis of different cellular fractions. Additionally, virulence studies in appropriate infection models can establish the importance of Lgt for S. paratyphi C pathogenesis in vivo .

How can researchers overcome challenges in studying the structure-function relationship of S. paratyphi C Lgt?

Studying the structure-function relationship of S. paratyphi C Lgt presents significant challenges due to its nature as an integral membrane protein with multiple transmembrane domains. To overcome these obstacles, researchers should implement a multi-faceted approach combining computational predictive methods with advanced experimental techniques. Initial structural insights can be gained through homology modeling based on the limited available structural data from related Lgt proteins, supplemented by secondary structure predictions and transmembrane topology analyses .

For experimental structure determination, researchers should explore lipid cubic phase crystallization or nanodiscs/amphipol stabilization techniques that maintain the membrane protein in a near-native environment. Cryo-electron microscopy represents another promising approach, particularly when combined with single-particle analysis of detergent-solubilized or nanodisc-reconstituted Lgt. Hydrogen-deuterium exchange mass spectrometry can provide valuable information about solvent accessibility and conformational dynamics of different protein regions without requiring full structural determination .

To connect structural insights with function, systematic site-directed mutagenesis should target conserved residues identified through multiple sequence alignments of Lgt proteins from diverse bacterial species. Each mutant should be characterized for its effects on enzyme activity using the glycerol phosphate release assay, complementation of lgt-deficient strains, and impact on lipoprotein processing patterns as detected by Western blot analysis. Specific chemical modification of cysteine residues introduced at strategic positions can further probe the accessibility and functional importance of different protein regions .

Cross-linking studies combined with mass spectrometry can identify residues involved in substrate binding or catalysis, while thermostability assays in the presence of different substrates or inhibitors can reveal ligand-induced conformational changes. By integrating these diverse approaches, researchers can build a comprehensive understanding of the structure-function relationship of S. paratyphi C Lgt despite the challenges inherent in membrane protein research .

What are the implications of Lgt inhibition on S. paratyphi C virulence and potential therapeutic applications?

The implications of Lgt inhibition on S. paratyphi C virulence extend beyond simple growth inhibition, affecting multiple aspects of bacterial physiology and host-pathogen interactions. Based on studies with related bacteria, Lgt inhibition would likely lead to significant outer membrane permeabilization in S. paratyphi C, increasing susceptibility to host defense mechanisms such as complement-mediated killing and antimicrobial peptides. This permeabilization occurs because proper lipoprotein processing is essential for maintaining the structural integrity of the bacterial cell envelope .

From a therapeutic perspective, the identification of potent and selective Lgt inhibitors presents a promising antimicrobial strategy. Unlike inhibitors targeting other lipoprotein biosynthesis enzymes, Lgt inhibitors maintain their efficacy even when the major outer membrane lipoprotein gene (lpp) is deleted, suggesting a reduced potential for resistance development through this common escape mechanism. Researchers should explore combination therapy approaches, testing Lgt inhibitors in conjunction with conventional antibiotics to assess potential synergistic effects arising from increased membrane permeability .

The therapeutic potential of Lgt inhibitors should be evaluated through comprehensive in vitro and in vivo efficacy studies, alongside detailed pharmacokinetic/pharmacodynamic assessments and toxicity screenings to ensure safety for potential clinical applications .

How do environmental factors influence the expression and activity of S. paratyphi C Lgt?

The expression and activity of S. paratyphi C Lgt likely respond to various environmental cues encountered during infection and survival in different host niches. To systematically investigate these regulatory mechanisms, researchers should employ a combination of transcriptional, translational, and post-translational analyses under conditions mimicking different infection stages. Quantitative real-time PCR and RNA sequencing can monitor lgt transcript levels in response to variables such as temperature shifts (37°C vs. environmental temperatures), pH changes (neutral vs. acidic), oxygen limitation, nutrient availability, and exposure to host defense molecules .

At the protein level, Western blot analysis using specific antibodies against Lgt can track protein abundance under the same conditions, while activity assays measuring glycerol phosphate release from enzymatic reactions can determine whether environmental factors directly influence enzyme function independent of expression levels. Researchers should also explore whether specific sigma factors, transcriptional regulators, or small RNAs modulate lgt expression in response to stress conditions by performing chromatin immunoprecipitation sequencing (ChIP-seq) and genetic studies with regulatory mutants .

The composition of the bacterial membrane, particularly its phospholipid content, may significantly impact Lgt activity since phosphatidylglycerol serves as the diacylglyceryl donor for the reaction. Therefore, lipidomic analyses should be conducted to determine how environmental conditions affect membrane phospholipid profiles and consequently Lgt function. Temperature may be especially relevant, as it affects membrane fluidity and potentially enzyme accessibility to substrates .

Integration of these multilevel analyses will provide a comprehensive understanding of how S. paratyphi C modulates Lgt expression and activity in response to its environment, potentially revealing regulatory mechanisms that could be exploited for antimicrobial development or attenuated vaccine strain construction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.