Recombinant Salmonella paratyphi C Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; SPC_0645; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTH IDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWL FSAAAAR
Uniprot No.

Target Background

Function

Important Function: Reduces intracellular fluoride concentration, mitigating its toxicity.

Database Links

KEGG: sei:SPC_0645

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the crcB gene in Salmonella paratyphi C?

The crcB gene in Salmonella paratyphi C is part of the core genome conserved among Salmonella enterica serovars. Genomic analysis of S. paratyphi C RKS4594 has revealed chromosomal rearrangements compared to other Salmonella serovars like S. choleraesuis, mediated by prophage elements such as Gifsy-1 and Gifsy-2 . While crcB itself is not directly involved in these rearrangements, understanding the genomic context is crucial for studying gene expression and regulation. When conducting genomic analyses, researchers should consider using whole-genome sequencing approaches that have been successfully employed for phylogenetic comparisons of Salmonella strains .

How is Salmonella paratyphi C identified and differentiated from other Salmonella serovars in laboratory settings?

S. paratyphi C can be identified and differentiated from other Salmonella serovars using several methods:

  • Real-time PCR assays using specific gene targets: The SPC0869 gene, encoding a hypothetical protein, has been identified as a potential marker for S. Paratyphi C identification . This target appears to be unique to S. Paratyphi C, though validation across larger populations is needed.

  • Artificial neural network classifiers based on FTIR-spectroscopy: These classifiers can discriminate S. Paratyphi C from non-typhoidal serovars with 99.0% accuracy, 100% sensitivity, and 100% specificity when using Columbia Blood agar culture medium .

  • Multi-target PCR approach: Using defined gene profiles, researchers can develop PCR assays that distinguish typhoidal (HG3) from non-typhoidal (HG2) Salmonella and identify specific serovars including S. Paratyphi C .

These identification methods are important prerequisites for isolating S. paratyphi C strains before proceeding with crcB studies.

What enrichment procedures are recommended when isolating S. paratyphi C for subsequent protein studies?

Enteric samples for both Salmonella bacterial culture and PCR detection require an overnight enrichment process to optimize growth, recovery, and detection . This step is particularly important for light infections or when bacteria are inhibited. For S. paratyphi C isolation from clinical samples:

  • Use selective enrichment media appropriate for typhoidal Salmonella

  • Incubate for 18-24 hours at 37°C

  • Confirm isolates using the real-time PCR assays targeting specific S. paratyphi C markers

  • For subsequent protein studies, validate isolates using FTIR-spectroscopy with an accuracy of 99.0% on Columbia Blood agar

This enrichment protocol improves detection sensitivity and ensures reliable isolation of S. paratyphi C strains for subsequent crcB protein expression studies.

How does the crcB homolog in S. paratyphi C differ structurally and functionally from crcB in other typhoidal Salmonella strains?

The crcB homolog in S. paratyphi C likely shares core structural elements with other Salmonella crcB proteins, but may contain serovar-specific variations. Comparative genomic analyses have shown that typhoidal Salmonella serovars exhibit distinct patterns of gene deletion and pseudogene formation . When investigating structural and functional differences:

  • Perform comparative sequence analysis across S. Typhi, S. Paratyphi A, B, and C

  • Use structural prediction tools to identify potential differences in transmembrane domains

  • Conduct fluoride resistance assays to determine functional variations

  • Employ site-directed mutagenesis to identify critical residues specific to S. paratyphi C crcB

The phylogenetic distinctiveness of S. paratyphi C, as evidenced by whole-genome sequence analysis , suggests there may be functional adaptations in its crcB homolog compared to other typhoidal strains.

What role does crcB play in S. paratyphi C virulence and host adaptation?

While crcB is primarily characterized as a fluoride channel, its potential contributions to virulence and host adaptation in S. paratyphi C warrant investigation due to:

  • Ion homeostasis being critical for bacterial survival during infection

  • Potential interactions with host defense mechanisms

  • Possible moonlighting functions in stress response pathways

S. paratyphi C has undergone genetic divergence through deletion and pseudogene formation during adaptation to human hosts . Investigating whether crcB expression is altered during different infection stages could provide insights into its potential role in pathogenicity. Research approaches should include:

  • Transcriptomic profiling of S. paratyphi C during infection models

  • Construction of crcB knockout strains to assess virulence attenuation

  • Host cell invasion assays comparing wild-type and crcB mutants

  • Examination of crcB expression under conditions mimicking the host environment

How reliable are current molecular detection methods for studying crcB expression in S. paratyphi C clinical isolates?

Current molecular detection methods for S. paratyphi C have been validated with high accuracy:

MethodAccuracySensitivitySpecificityReference
Real-time PCR (multi-target)Not specified100%100%
FTIR-spectroscopy with CBA medium99.0%100%100%
FTIR-spectroscopy with TSA medium95.5%Not specifiedNot specified

For studying crcB expression specifically, researchers should consider:

  • Developing crcB-specific primers with validation against the S. paratyphi C genome

  • Using RT-qPCR with appropriate reference genes validated for stability in S. paratyphi C

  • Implementing proper controls to account for variations in clinical isolates

  • Considering the impact of enrichment procedures on gene expression profiles

The automated classifiers developed for S. paratyphi C identification could potentially be adapted to study isolates with varying crcB expression levels.

What expression systems are most suitable for producing recombinant S. paratyphi C CrcB protein?

For optimal expression of recombinant S. paratyphi C CrcB protein:

  • E. coli-based systems:

    • BL21(DE3) strain for high-level expression

    • C41(DE3) or C43(DE3) for membrane proteins like CrcB

    • Consider codon optimization for the heterologous host

  • Expression vectors:

    • pET series with T7 promoter for controlled induction

    • Vectors containing fusion tags (His, MBP, or GST) to aid purification

    • Inducible promoters with tight regulation to control toxicity

  • Expression conditions:

    • Lower temperatures (16-25°C) to improve proper folding

    • Reduced inducer concentrations for membrane proteins

    • Addition of specific ions (e.g., fluoride) that might stabilize the protein

  • Extraction considerations:

    • Specialized detergents for membrane protein solubilization

    • Purification under conditions that maintain native conformation

The choice of expression system should be validated through pilot expressions followed by functional assays to ensure the recombinant protein retains its native properties.

What are the key considerations when designing fluoride transport assays for recombinant S. paratyphi C CrcB?

When designing fluoride transport assays for recombinant CrcB:

  • Vesicle-based assays:

    • Reconstitute purified CrcB into liposomes

    • Use fluoride-sensitive fluorescent probes (e.g., PBFI) to monitor transport

    • Control for leakage and non-specific transport

  • Whole-cell assays:

    • Express CrcB in fluoride-sensitive bacterial strains lacking endogenous crcB

    • Monitor growth inhibition at varying fluoride concentrations

    • Include appropriate controls (empty vector, inactive mutants)

  • Electrophysiological approaches:

    • Patch-clamp recordings of CrcB-containing membranes

    • Planar lipid bilayer recordings to measure single-channel conductance

    • Control for other ion channels that might be present

  • Controls and validations:

    • Test specificity with other halides (chloride, bromide)

    • Validate using site-directed mutants of known functional residues

    • Compare with CrcB homologs from other well-characterized bacteria

These assays should be performed under conditions that mimic the physiological environment of S. paratyphi C during infection.

How can researchers effectively study crcB gene regulation in the context of S. paratyphi C pathogenesis?

To study crcB regulation in S. paratyphi C pathogenesis:

  • Transcriptional regulation:

    • Construct promoter-reporter fusions (e.g., GFP, luciferase)

    • Analyze expression under various stress conditions relevant to infection

    • Use ChIP-seq to identify transcription factors binding to the crcB promoter

  • Post-transcriptional regulation:

    • Investigate potential small RNA regulators using RNA-seq approaches

    • Analyze mRNA stability under different conditions

    • Examine ribosome binding and translation efficiency

  • In vivo expression:

    • Develop in vivo expression technology (IVET) systems for S. paratyphi C

    • Use animal infection models to track crcB expression during pathogenesis

    • Implement tissue-specific collection methods to analyze expression in different host niches

  • Integration with other datasets:

    • Correlate crcB expression with global transcriptional profiles

    • Analyze co-expression networks to identify functional relationships

    • Compare with expression patterns of known virulence factors

The typhoidal nature of S. paratyphi C necessitates careful consideration of biosafety measures when designing these experiments .

How should researchers interpret conflicting data regarding crcB function across different Salmonella serovars?

When faced with conflicting data about crcB function across Salmonella serovars:

  • Contextual considerations:

    • Genomic context variations among serovars (demonstrated through whole-genome comparisons)

    • Methodological differences between studies

    • Strain-specific adaptations related to host specificity

  • Analytical approaches:

    • Conduct systematic meta-analysis of existing data

    • Perform head-to-head comparisons using standardized protocols

    • Use evolutionary models to trace functional divergence

  • Reconciliation strategies:

    • Develop unifying hypotheses that explain serovar-specific differences

    • Identify environmental or host factors that might explain variable results

    • Design experiments to directly test competing hypotheses

  • Technical validation:

    • Cross-validate using multiple experimental approaches

    • Employ both in vitro and in vivo systems

    • Use complementation studies to confirm gene function

S. paratyphi C's position in the phylogenetic tree of Salmonella serovars provides context for interpreting functional differences in conserved proteins like CrcB.

What bioinformatic approaches are most appropriate for analyzing evolutionary conservation of crcB across Salmonella species?

For analyzing evolutionary conservation of crcB:

  • Sequence-based analyses:

    • Multiple sequence alignment of crcB across Salmonella serovars

    • Calculation of dN/dS ratios to detect selective pressure

    • Identification of conserved domains and critical residues

  • Structural predictions:

    • Homology modeling based on known CrcB structures

    • Molecular dynamics simulations to assess functional implications of sequence variations

    • Prediction of protein-protein interaction interfaces

  • Phylogenetic approaches:

    • Construction of gene trees vs. species trees to detect horizontal gene transfer

    • Bayesian evolutionary analysis for detecting clade-specific adaptations

    • Ancestral sequence reconstruction to trace evolutionary trajectories

  • Contextual genomics:

    • Analysis of synteny and operon structure conservation

    • Examination of regulatory element conservation

    • Integration with whole-genome phylogenetic analyses as performed for typhoidal Salmonella

The observed genetic divergence patterns in typhoidal Salmonella provide a framework for understanding crcB evolution in this pathogen group.

How can researchers differentiate between direct and indirect effects when studying crcB knockout phenotypes in S. paratyphi C?

To differentiate between direct and indirect effects in crcB knockout studies:

  • Complementation studies:

    • Restore wild-type phenotype with plasmid-encoded crcB

    • Use site-directed mutants to map functional domains

    • Employ heterologous complementation with crcB from other organisms

  • Multi-omics approaches:

    • Compare transcriptomes of wild-type and ΔcrcB strains

    • Analyze the proteome to identify compensatory changes

    • Perform metabolomics to detect altered metabolic pathways

  • Time-resolved analyses:

    • Monitor phenotypic changes immediately after crcB inactivation

    • Use inducible expression systems for temporal control

    • Track cellular responses over time to separate primary from secondary effects

  • Targeted biochemical assays:

    • Measure direct biochemical activities (e.g., fluoride transport)

    • Quantify specific cellular parameters known to be affected by ion homeostasis

    • Perform in vitro reconstitution with purified components

Using the molecular identification techniques validated for S. paratyphi C , researchers can ensure the genetic background authenticity of strains used in these experiments.

What are the most reliable methods for purifying functional CrcB protein from recombinant expression systems?

For purifying functional CrcB protein:

  • Membrane extraction:

    • Optimize cell lysis conditions to preserve protein integrity

    • Use gentle detergents (DDM, LMNG) for membrane solubilization

    • Consider native membrane extraction vs. inclusion body refolding

  • Affinity purification:

    • Design constructs with appropriate affinity tags (His, FLAG, Strep)

    • Optimize binding and elution conditions for maximum recovery

    • Consider on-column refolding for improved functionality

  • Size exclusion chromatography:

    • Separate protein oligomers from aggregates and contaminants

    • Analyze oligomeric state for functional correlation

    • Optimize buffer composition to maintain stability

  • Functional validation:

    • Develop activity assays to test each purification fraction

    • Monitor protein stability over time using thermal shift assays

    • Confirm proper folding using circular dichroism or fluorescence spectroscopy

The multi-step validation approaches used for Salmonella identification provide a model for rigorous quality control in protein purification.

How can researchers effectively investigate potential interactions between CrcB and other Salmonella proteins?

To investigate CrcB protein interactions:

  • Co-immunoprecipitation approaches:

    • Use epitope-tagged CrcB to pull down interaction partners

    • Perform reverse co-IP to confirm interactions

    • Include appropriate controls to filter out non-specific binding

  • Bacterial two-hybrid systems:

    • Adapt existing two-hybrid systems for membrane protein analysis

    • Screen against genomic libraries of S. paratyphi C

    • Validate interactions using alternative methods

  • Proximity labeling techniques:

    • Employ BioID or APEX2 fusions to CrcB

    • Identify nearby proteins in the native cellular environment

    • Distinguish between stable and transient interactions

  • Structural studies:

    • Use cross-linking mass spectrometry to map interaction interfaces

    • Perform co-crystallization or cryo-EM with potential partners

    • Employ molecular docking to predict interaction sites

These approaches should be integrated with genomic context information derived from whole-genome analyses of S. paratyphi C to identify biologically relevant interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.