Recombinant Salmonella paratyphi C Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Description

Function and Significance of MdtI

MdtI is a spermidine export protein, which is significant for the following reasons:

  • Spermidine Transport: MdtI facilitates the export of spermidine, which is a polyamine that helps Salmonella mount an antioxidative response .

  • Stress Response: Spermidine is critical for Salmonella's stress response mechanism, helping it to regulate antioxidant genes . Mutants lacking spermidine transport are unable to mount an antioxidative response, leading to high levels of intracellular reactive oxygen species (ROS) .

  • Macrophage Interaction: Spermidine transport mutants show a compromised ability to be phagocytosed by macrophages, indicating its importance in the bacteria's interaction with host immune cells .

  • Antioxidative Enzyme Regulation: Spermidine regulates glutathionyl-spermidine synthetase (GspSA), a novel enzyme in Salmonella that prevents protein oxidation . Mutants of GspSA show reduced survival in the presence of hydrogen peroxide and reduced organ burden in mouse models of Salmonella infection .

Recombinant Production

Recombinant MdtI is produced using various expression systems, each with its own advantages:

  • E. coli: A common host for recombinant protein production due to its rapid growth and ease of genetic manipulation .

  • Yeast: Suitable for producing more complex proteins that require post-translational modifications .

  • Baculovirus: Used for expressing proteins in insect cells, offering a balance between prokaryotic and eukaryotic expression systems .

  • Mammalian Cells: Preferred for producing proteins that require specific mammalian post-translational modifications for activity and folding .

Table 1: Recombinant MdtI Production Systems

Expression SystemAdvantagesConsiderations
E. coliFast growth, high yield, cost-effectiveMay lack proper post-translational modifications
YeastCapable of some eukaryotic post-translational modificationsGlycosylation patterns may differ from mammalian cells
BaculovirusGood for large, complex proteinsCan be more expensive than bacterial or yeast systems
Mammalian CellsAuthentic post-translational modificationsLower yield, higher cost, more complex culture requirements

Research Findings

  • Antioxidative Response: Spermidine transport and synthesis mutants of Salmonella Typhimurium exhibit reduced survival upon infection in macrophages. Spermidine manipulates the antioxidative response and regulates intracellular ROS levels .

  • Host Polyamine Biosynthesis: Salmonella Typhimurium harnesses host polyamine biosynthesis for its survival. Inhibiting host polyamine biosynthesis reduces Salmonella colonization and tissue damage while enhancing the survival of infected mice .

  • Virulence Factors: S. paratyphi C contains a virulence plasmid, pSPCV, which shares high sequence identity with virulence plasmids in other Salmonella species. These plasmids contain operons (spv, pef, and tra) that are important for the systemic phase of infection .

  • Genetic Divergence: S. paratyphi C has distinct amino acid differences compared to other Salmonella serovars, suggesting specific adaptations to its human host .

Applications

Recombinant Salmonella paratyphi C Spermidine export protein MdtI (mdtI) is used in a variety of applications:

  • ELISA Assays: Recombinant MdtI can be used in enzyme-linked immunosorbent assays (ELISA) for detecting antibodies against Salmonella paratyphi C .

  • Drug Discovery: MdtI is a target for developing new drugs to combat Salmonella infections . Inhibiting spermidine transport could compromise the bacteria's ability to survive and cause disease .

  • Vaccine Development: Attenuated Salmonella strains producing the Vi capsular polysaccharide are promising bivalent vaccine candidates for preventing enteric fever .

  • Protein Dynamics: Molecular dynamics simulations and analyses, such as RMSD, gyration radius, and RMSF, provide insights into protein dynamics and flexibility, aiding in understanding MdtI's function .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mdtI; SPC_2247; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
mdtI
Target Protein Sequence
MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA
Uniprot No.

Target Background

Function

Function: Catalyzes the excretion of spermidine.

Database Links

KEGG: sei:SPC_2247

Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtI protein and what is its primary function?

MdtI is a spermidine export protein that functions as part of the MdtJI complex in Salmonella species. It belongs to the small multidrug resistance (SMR) family of drug exporters. The primary function of the MdtJI complex is the excretion of spermidine, a polyamine that can become toxic when overaccumulated within bacterial cells. Both mdtJ and mdtI genes are necessary for the recovery from toxicity caused by excessive intracellular spermidine levels . The MdtJI complex catalyzes the active transport of spermidine from the bacterial cytoplasm to the extracellular environment, playing a crucial role in polyamine homeostasis within the cell .

How does the MdtJI complex respond to spermidine levels in bacterial cells?

The MdtJI complex shows a dynamic response to spermidine levels within the bacterial cell. Research has demonstrated that the level of mdtJI mRNA increases in the presence of spermidine, indicating a transcriptional regulatory response to elevated polyamine levels . When bacteria are cultured in the presence of 2 mM spermidine, cells expressing functional MdtJI complex show decreased intracellular spermidine content and enhanced excretion of spermidine compared to control cells. This confirms that the MdtJI complex functions as a spermidine-responsive export system that helps maintain optimal intracellular polyamine concentrations .

What are the recommended expression systems for recombinant MdtI production?

Based on established protocols, E. coli expression systems are the preferred platform for recombinant MdtI production . The protein can be expressed with an N-terminal His-tag to facilitate downstream purification processes. When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli

  • Selection of appropriate promoter systems (T7 or similar inducible promoters)

  • Inclusion of appropriate signal sequences if membrane targeting is required

  • Temperature optimization during induction (typically lower temperatures of 16-25°C may improve membrane protein folding)

For optimal results, expression in specialized E. coli strains designed for membrane protein production (such as C41(DE3) or C43(DE3)) may yield better results than standard laboratory strains .

What purification methods are most effective for recombinant MdtI?

Purification of recombinant His-tagged MdtI typically involves:

  • Cell lysis under conditions that preserve membrane protein structure

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using appropriate detergents (DDM, LDAO, or similar mild detergents)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices

  • Optional size exclusion chromatography for higher purity

The purified protein should be maintained in a stabilizing buffer containing appropriate detergent concentrations and possibly lipids to maintain native-like conformation .

What are the recommended storage conditions for recombinant MdtI?

According to product information, recombinant MdtI is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add 5-50% glycerol (final concentration) and aliquot for storage at -20°C/-80°C. The default final concentration of glycerol is typically 50% .

Repeated freeze-thaw cycles should be avoided as they can damage the protein structure. Working aliquots can be stored at 4°C for up to one week . The storage buffer typically consists of a Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain protein stability .

What methods can be used to assess MdtI function in spermidine export?

Several experimental approaches can be employed to evaluate MdtI function in spermidine export:

  • Genetic complementation assays: Using an E. coli strain deficient in spermidine acetyltransferase (which would normally be sensitive to spermidine toxicity), introduce plasmids expressing mdtJ and mdtI and evaluate recovery from growth inhibition in the presence of spermidine .

  • Spermidine content measurement: Quantify intracellular spermidine levels using HPLC or LC-MS/MS in cells with and without functional MdtJI complex when cultured in spermidine-containing media .

  • Radiolabeled spermidine efflux assays: Load cells with radiolabeled spermidine and measure efflux rates in cells expressing wild-type versus mutant MdtI proteins.

  • mRNA expression analysis: Use RT-qPCR to quantify mdtJI mRNA levels in response to varying spermidine concentrations to evaluate transcriptional regulation .

These methods can be combined to provide a comprehensive assessment of MdtI function in spermidine export processes.

How can site-directed mutagenesis be used to study MdtI function?

Site-directed mutagenesis is a powerful approach for studying the structure-function relationship of MdtI. Research has identified several key amino acid residues in MdtI that are critical for spermidine export function, including Glu5, Glu19, Asp60, Trp68, and Trp81 . A systematic mutagenesis approach could include:

  • Selection of target residues: Based on sequence conservation, predicted membrane topology, or known functional sites.

  • Mutagenesis strategy:

    • Alanine scanning for initial identification of functional residues

    • Conservative substitutions to probe specific chemical requirements

    • Introduction of charged residues to disrupt membrane domains

  • Functional validation:

    • Complementation assays in MdtI-deficient strains

    • Spermidine export measurement using methods described in 3.1

    • Protein expression and localization assessment to ensure proper folding

  • Analysis of results:

    • Correlation of mutation effects with predicted structural features

    • Comparison with homologous transporters from other species

    • Development of a functional model for spermidine transport

This approach has already yielded important insights, such as the identification of the acidic residues (Glu5, Glu19, Asp60) and aromatic residues (Trp68, Trp81) that are critical for MdtI function .

How does MdtI contribute to Salmonella pathogenesis and survival in host environments?

The contribution of MdtI to Salmonella pathogenesis can be examined in the context of the general pathogenesis mechanism of Salmonella infections. Salmonella species are known to invade host cells, particularly in the distal ileum, and subsequently replicate in phagocytes within systemic tissues including the spleen, liver, and bone marrow .

Polyamine homeostasis, regulated in part by the MdtJI complex, may play several roles in this process:

  • Protection against host defense mechanisms: Appropriate regulation of intracellular spermidine levels may help bacteria survive oxidative stress within phagocytic cells.

  • Adaptation to nutrient limitations: During infection, bacteria must adapt to changing nutrient conditions, and polyamine export systems like MdtJI may help maintain optimal intracellular environments.

  • Biofilm formation: Polyamines have been implicated in biofilm formation, which can enhance bacterial persistence in host environments.

  • Antibiotic resistance: As part of the small multidrug resistance family, MdtI may contribute to antibiotic resistance mechanisms, particularly in conjunction with other resistance determinants such as those encoded on plasmids like pHXY0908 .

Research approaches to investigate these aspects could include:

  • Construction of mdtI knockout strains and evaluation of their virulence in cell culture and animal models

  • Transcriptomic analysis of mdtI expression during different phases of infection

  • Assessment of spermidine export in response to host-derived stress signals

What is the relationship between MdtI function and antibiotic resistance in Salmonella species?

As a member of the small multidrug resistance (SMR) family, MdtI may have broader implications for antibiotic resistance beyond its primary role in spermidine export. While the search results don't directly address this relationship, several hypotheses can be formulated based on known SMR protein functions:

  • Direct efflux of antimicrobial compounds: Some SMR proteins can directly export certain antibiotics, reducing their intracellular concentration below inhibitory levels.

  • Indirect effects on membrane permeability: Altered polyamine homeostasis due to MdtI activity may affect membrane properties and consequently drug penetration.

  • Interaction with other resistance mechanisms: MdtI may work in concert with other resistance determinants, such as those encoded on resistance plasmids like pHXY0908, which has been shown to increase resistance to ciprofloxacin in S. Typhimurium .

To investigate these possibilities, researchers could:

  • Determine minimum inhibitory concentrations (MICs) for various antibiotics in wild-type versus mdtI-deleted strains

  • Assess the impact of mdtI overexpression on antibiotic susceptibility

  • Evaluate the effect of spermidine levels on antibiotic efficacy

  • Study the interaction between MdtI and other known resistance determinants

How can structural studies of MdtI inform drug development targeting Salmonella infections?

Structural studies of MdtI could provide valuable insights for drug development targeting Salmonella infections. As a membrane protein involved in a critical homeostatic process, MdtI represents a potential target for novel antimicrobial agents. Key research directions include:

  • Structural determination approaches:

    • X-ray crystallography of purified MdtI, possibly in complex with spermidine or inhibitors

    • Cryo-electron microscopy of the MdtJI complex

    • NMR studies of specific domains or the full protein in membrane mimetics

    • Computational modeling based on homologous proteins with known structures

  • Structure-based drug design possibilities:

    • Identification of binding pockets for small molecule inhibitors

    • Design of peptidomimetics that could disrupt the MdtJI complex formation

    • Development of allosteric modulators that could alter transport function

  • Potential advantages as a drug target:

    • Membrane location provides accessibility for drug binding

    • Essential function in polyamine homeostasis

    • Distinct from human transporters, potentially allowing for selective targeting

Inhibition of MdtI function could potentially increase bacterial sensitivity to host defense mechanisms and conventional antibiotics by disrupting polyamine homeostasis, representing a novel strategy to combat Salmonella infections.

What are the main challenges in working with recombinant MdtI and how can they be addressed?

Working with membrane proteins like MdtI presents several challenges:

  • Expression and solubility issues:

    • Challenge: Low expression levels and inclusion body formation

    • Solution: Optimize expression conditions (temperature, inducer concentration), use specialized host strains, and employ fusion tags that enhance solubility

  • Protein stability concerns:

    • Challenge: Membrane proteins often denature rapidly outside their native environment

    • Solution: Use appropriate detergents and lipids, optimize buffer conditions (pH, salt concentration), and consider adding stabilizing agents like glycerol or specific ligands

  • Functional assay limitations:

    • Challenge: Difficult to assess transport function in purified systems

    • Solution: Develop reconstituted proteoliposome systems, use fluorescent spermidine analogs, or employ indirect assays such as ATPase activity measurements

  • Interaction studies complexities:

    • Challenge: Studying MdtJ-MdtI interactions can be technically demanding

    • Solution: Employ techniques like FRET, crosslinking studies, or co-immunoprecipitation with appropriate controls

  • Structural analysis difficulties:

    • Challenge: Membrane proteins are challenging for structural determination

    • Solution: Screen multiple constructs and conditions for crystallization, consider alternative approaches like cryo-EM, or use computational modeling supplemented with experimental validation

How can researchers effectively study the MdtJ-MdtI interaction in vitro?

The MdtJI complex formation is essential for spermidine export function, making the study of this interaction critical for understanding the system. Effective approaches include:

  • Co-expression and co-purification:

    • Use dual expression vectors with different affinity tags on each protein

    • Perform tandem affinity purification to isolate the intact complex

    • Analyze complex formation by gel filtration chromatography and native PAGE

  • Protein-protein interaction assays:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Split-GFP complementation assays in bacterial cells

    • FRET or BRET using appropriately tagged proteins in reconstituted systems

  • Crosslinking studies:

    • Use chemical crosslinkers with different spacer lengths to map interaction sites

    • Employ photo-activatable crosslinkers for targeted interaction studies

    • Analyze crosslinked products by mass spectrometry to identify contact points

  • Mutagenesis approaches:

    • Perform systematic mutagenesis of predicted interface residues

    • Measure effects on complex formation and spermidine export function

    • Develop interaction maps based on mutational data

  • Biophysical characterization:

    • Isothermal titration calorimetry with purified components

    • Surface plasmon resonance to measure binding kinetics

    • Microscale thermophoresis for interaction studies in solution

These approaches can provide complementary information about the nature, specificity, and dynamics of the MdtJ-MdtI interaction that is essential for spermidine export function.

How can comparative studies of MdtI across different Salmonella serovars inform our understanding of bacterial evolution and adaptation?

Comparative studies of MdtI across different Salmonella serovars, including Paratyphi A, B, and C, can provide valuable insights into bacterial evolution and adaptation:

  • Sequence conservation analysis:

    • Identify conserved versus variable regions across serovars

    • Correlate conservation patterns with functional domains

    • Infer evolutionary pressure on different protein regions

  • Functional comparison approaches:

    • Assess spermidine export efficiency of MdtI from different serovars

    • Evaluate cross-complementation between serovars

    • Measure adaptation to different environmental spermidine concentrations

  • Host adaptation implications:

    • Compare MdtI function between host-restricted versus broad-host-range serovars

    • Assess potential correlation with virulence in different host species

    • Determine if MdtI variation contributes to niche adaptation

  • Evolutionary context:

    • Analyze mdtI in the context of genome evolution and horizontal gene transfer

    • Evaluate if mdtI is part of the core or accessory genome

    • Determine if mdtI shows evidence of recombination events

Understanding the evolution of MdtI across Salmonella serovars could provide insights into how these pathogens have adapted to different environmental niches and host environments, potentially informing strategies for control and prevention of salmonellosis.

What is the potential of targeting MdtI for antimicrobial development against drug-resistant Salmonella strains?

The potential of targeting MdtI for antimicrobial development against drug-resistant Salmonella strains is a promising area for investigation:

  • Rationale for targeting MdtI:

    • Essential role in polyamine homeostasis

    • Part of the SMR family implicated in drug resistance

    • No direct human homolog, reducing off-target effects

    • Membrane location provides accessibility for drug binding

  • Potential approaches:

    • Small molecule inhibitors that block the spermidine binding site

    • Peptidomimetics that disrupt MdtJ-MdtI complex formation

    • Allosteric modulators that alter transporter conformation

    • Conjugation of existing antibiotics to target MdtI-expressing cells

  • Combination therapy potential:

    • MdtI inhibitors could be used to sensitize bacteria to conventional antibiotics

    • Particularly relevant for multi-drug resistant strains like those carrying plasmids such as pHXY0908

    • Could potentially reduce required antibiotic doses, minimizing side effects

  • Challenges to address:

    • Need for high-throughput screening systems for MdtI inhibitors

    • Development of appropriate animal models to test efficacy

    • Potential for resistance development through mutations in mdtI

  • Translational considerations:

    • Route of administration considerations (oral vs. parenteral)

    • Pharmacokinetic and pharmacodynamic optimization

    • Target population selection (e.g., patients with drug-resistant infections)

Given the increasing prevalence of drug-resistant Salmonella strains, novel targets like MdtI represent an important avenue for future antimicrobial development efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.