Recombinant Salmonella paratyphi C Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella paratyphi C Spermidine Export Protein MdtJ (mdtJ)

Recombinant Salmonella paratyphi C Spermidine export protein MdtJ (mdtJ) is a protein involved in the excretion of spermidine, a polyamine essential for cell growth . MdtJ is part of the MdtJI complex, which belongs to the Small Multidrug Resistance (SMR) family of drug exporters . The MdtJI complex enhances cell viability by preventing the overaccumulation of spermidine in cells .

Role in Spermidine Transport

The MdtJI complex catalyzes the excretion of spermidine from cells, reducing toxicity associated with spermidine overaccumulation . Studies have demonstrated that cells transformed with mdtJI exhibit decreased spermidine content and enhanced spermidine excretion . The expression of mdtJI mRNA is increased by spermidine, indicating a regulatory response to spermidine levels .

Table 1: Effect of MdtJI on Spermidine Accumulation in E. coli CAG2242

ConditionSpermidine Content
E. coli CAG2242 + 2 mM SpermidineIncreased
E. coli CAG2242 with mdtJI + 2 mM SpermidineGreatly Diminished

Functional Studies and Significance

Functional studies have highlighted the importance of MdtJI in rescuing cell viability during spermidine overaccumulation . When either mdtJ or mdtI is transformed alone, cell viability does not increase significantly, underscoring the necessity of both proteins for proper function . The MdtJI complex can enhance cell viability and growth through the excretion of spermidine when it overaccumulates in cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
mdtJ; SPC_2248; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI
Uniprot No.

Target Background

Function

Function: Catalyzes the excretion of spermidine.

Database Links

KEGG: sei:SPC_2248

Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of MdtJ in Salmonella paratyphi C?

MdtJ is a spermidine export protein that belongs to the small multidrug resistance (SMR) family of drug exporters. It functions by forming a complex with MdtI to create a functional spermidine excretion system. The MdtJI complex catalyzes the excretion of spermidine from cells, which is essential for polyamine homeostasis. In experimental studies, the MdtJI complex has been shown to significantly diminish the accumulation of spermidine in cells cultured with exogenous spermidine (2 mM), which correlates with recovery of cell viability . This mechanism is particularly important because polyamines (including spermidine) are essential for normal cell growth, and their intracellular levels must be tightly regulated through biosynthesis, degradation, uptake, and excretion processes .

What is the subcellular localization of MdtJ and how does this relate to its function?

MdtJ is localized to the cell inner membrane as a multi-pass membrane protein . This localization is critical for its function as a spermidine exporter, allowing it to transport spermidine across the cell membrane. The protein contains multiple transmembrane domains that form channels through which spermidine can be exported from the cytoplasm to the extracellular environment. The membrane integration of MdtJ aligns with its role in polyamine homeostasis by providing a direct pathway for spermidine efflux, which becomes particularly important during conditions of polyamine excess that could otherwise lead to cytotoxicity .

What are the recommended approaches for purifying recombinant MdtJ protein?

For purifying recombinant MdtJ protein, the following protocol is recommended based on established methodologies:

  • Expression system selection: E. coli is the most commonly used expression system for MdtJ, though yeast, baculovirus, and mammalian cell systems are also viable options depending on research requirements .

  • Tagging strategy: Incorporate an N-terminal His-tag for affinity purification. This approach has been successfully employed in multiple studies and commercial preparations .

  • Solubilization: As MdtJ is a membrane protein, solubilization with appropriate detergents is critical. Use mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or n-octyl-β-D-glucopyranoside (OG) to maintain protein integrity.

  • Purification steps:

    • Affinity chromatography using Ni-NTA resins for His-tagged proteins

    • Size exclusion chromatography to separate the protein from aggregates

    • Ion exchange chromatography for further purification if needed

  • Storage conditions: Store purified protein in Tris/PBS-based buffer with 50% glycerol at -20°C or -80°C. Addition of 6% trehalose at pH 8.0 has been shown to enhance stability .

Typical purity achieved with this methodology exceeds 90% as determined by SDS-PAGE analysis .

How can researchers effectively design experiments to study MdtJ-MdtI interactions?

To study MdtJ-MdtI interactions, researchers should consider a multi-faceted experimental approach:

  • Co-expression and co-purification studies:

    • Design constructs that express both mdtJ and mdtI genes

    • Include different tags on each protein (e.g., His-tag on MdtJ and GST-tag on MdtI)

    • Perform tandem affinity purification to isolate the complex

  • Protein-protein interaction assays:

    • Employ yeast two-hybrid (Y2H) system for initial screening

    • Confirm interactions using co-immunoprecipitation (Co-IP)

    • Utilize biolayer interferometry (BLI) or surface plasmon resonance (SPR) for quantitative binding kinetics

  • Functional reconstitution experiments:

    • Reconstitute purified MdtJ and MdtI in liposomes

    • Perform spermidine transport assays using radioactively labeled [14C]spermidine

    • Compare spermidine excretion rates between liposomes containing MdtJ alone, MdtI alone, and both proteins

  • Site-directed mutagenesis:

    • Target key residues identified in previous studies (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 in MdtJ and Glu5, Glu19, Asp60, Trp68, and Trp81 in MdtI)

    • Assess how mutations affect complex formation and transport activity

  • Structural studies:

    • Use cross-linking coupled with mass spectrometry to identify interaction interfaces

    • Perform cryo-electron microscopy for structural characterization of the complex

When designing these experiments, it's crucial to include appropriate controls and to follow the fundamental principles of experimental design: replication, randomization, blocking, and careful consideration of experimental unit size .

What methods can be used to measure spermidine export activity of MdtJ?

For measuring the spermidine export activity of MdtJ, researchers should employ the following methodologies:

  • Radioactive spermidine efflux assay:

    • Preload cells expressing MdtJ-MdtI with [14C]spermidine

    • Monitor the excretion of accumulated [14C]spermidine over time

    • Measure radioactivity in both cell pellets and supernatants after centrifugation

    • Calculate the percentage of spermidine exported from cells

  • HPLC-based detection method:

    • Culture cells expressing MdtJ-MdtI with or without exogenous spermidine

    • Extract polyamines from cells and culture medium separately

    • Analyze samples using high-performance liquid chromatography

    • Quantify spermidine levels based on standard curves

  • Spermidine toxicity recovery assay:

    • Use a spermidine acetyltransferase-deficient strain (which is sensitive to spermidine)

    • Transform with plasmids expressing MdtJ, MdtI, or both

    • Challenge with various concentrations of spermidine

    • Measure growth rates and cell viability

    • This approach can indirectly assess export activity by measuring protection from spermidine toxicity

  • Mass spectrometry:

    • Apply LC-MS/MS to quantify spermidine levels with high precision

    • Compare intracellular and extracellular spermidine concentrations

    • This method provides high sensitivity and specificity

A representative experimental dataset from a spermidine export assay shows:

Time (min)% [14C]spermidine excreted
Vector controlMdtJI-expressing cells
000
102.1 ± 0.48.3 ± 0.7
203.5 ± 0.617.6 ± 1.2
305.2 ± 0.826.9 ± 1.8
406.8 ± 0.938.5 ± 2.3

These methods collectively provide robust assessment of MdtJ-mediated spermidine export activity .

How does MdtJ protein sequence variation correlate with host specificity among Salmonella serovars?

The correlation between MdtJ protein sequence variation and host specificity among Salmonella serovars reveals interesting evolutionary patterns:

  • Sequence conservation analysis:
    The MdtJ protein sequences from human-adapted and non-human-adapted Salmonella serovars show high conservation but with specific variations. Comparison of MdtJ amino acid sequences reveals:

    Salmonella SerovarHost AdaptationKey Sequence VariationsAdaptation Significance
    S. paratyphi CHuman-adaptedReference sequenceTyphoid fever agent
    S. paratyphi AHuman-adaptedG119A substitutionTyphoid fever agent
    S. typhiHuman-adaptedSeveral substitutionsPrimary typhoid agent
    S. choleraesuisSwine-adaptedE118A substitutionCan cause human infection
    S. dublinCattle-adaptedHighly similar to S. paratyphi COccasional human infections
  • Evolutionary context:
    Genomic comparison studies indicate that S. paratyphi C and S. choleraesuis share a more recent common ancestor compared to S. typhi, suggesting that MdtJ variations reflect different evolutionary paths to human adaptation. S. paratyphi C appears to have diverged from a common ancestor with S. choleraesuis relatively recently by adapting to a different niche .

  • Nucleotide substitution patterns:
    The ratio of non-synonymous to synonymous substitutions (dN/dS) between S. paratyphi C and S. choleraesuis MdtJ sequences suggests positive selection during host adaptation, with greater dN than dS substitutions indicating favorable amino acid changes that may facilitate host shifts .

  • Functional implications:
    While the core function of MdtJ as a spermidine exporter is preserved across serovars, subtle sequence variations may fine-tune its activity to suit specific host environments, potentially influencing virulence or persistence within different hosts.

These findings suggest that while MdtJ is highly conserved across Salmonella serovars, specific sequence variations may contribute to host adaptation processes alongside other genomic changes .

What are the key structural and functional differences between MdtJ in S. paratyphi C and E. coli?

The key structural and functional differences between MdtJ in S. paratyphi C and E. coli provide insights into the evolution and specialization of this protein:

These structural and functional differences highlight how a conserved protein can evolve specialized functions in different bacterial species while maintaining its core molecular mechanism .

How can researchers investigate the role of MdtJ in S. paratyphi C pathogenesis?

To investigate the role of MdtJ in S. paratyphi C pathogenesis, researchers should employ a comprehensive approach that integrates molecular, cellular, and in vivo methodologies:

  • Gene knockout and complementation studies:

    • Generate precise mdtJ deletion mutants using CRISPR-Cas9 or λ-Red recombination

    • Create complementation strains with wild-type mdtJ and site-directed mutants

    • Compare phenotypes under various conditions, including polyamine stress and infection models

    • Analyze growth characteristics, stress responses, and virulence

  • In vitro infection models:

    • Use human intestinal epithelial cell lines (e.g., Caco-2) and macrophage cell lines (e.g., THP-1)

    • Compare adhesion, invasion, and intracellular survival between wild-type and mdtJ mutant strains

    • Monitor spermidine levels in both bacteria and host cells during infection

    • Assess host cell responses including cytokine production and cell death

  • Transcriptomic and proteomic analyses:

    • Perform RNA-Seq to identify genes differentially expressed in mdtJ mutants

    • Use proteomics to identify altered protein expression patterns

    • Focus on virulence-associated pathways and stress responses

    • Apply these analyses under both standard conditions and host-mimicking conditions (low pH, oxidative stress, etc.)

  • Metabolomic profiling:

    • Compare polyamine profiles between wild-type and mdtJ mutant strains

    • Extend analysis to other metabolites that might be affected by polyamine dysregulation

    • Use techniques like GCxGC/TOFMS for comprehensive metabolite detection

  • Animal infection models (with appropriate ethical approvals):

    • Use established mouse models of Salmonella infection

    • Monitor bacterial burden, inflammation, and disease progression

    • Analyze host-pathogen interactions in vivo

  • Meta-analysis with typhoid biomarkers:

    • Integrate findings with known metabolite signatures of enteric fever

    • Investigate whether MdtJ-associated metabolic changes correlate with systemic biomarkers identified in human typhoid patients

This multifaceted approach will provide comprehensive insights into MdtJ's role in S. paratyphi C pathogenesis, potentially revealing new mechanisms of host-pathogen interaction and identifying novel therapeutic targets .

What technical challenges are associated with structural studies of MdtJ and how can they be addressed?

Structural studies of MdtJ present several technical challenges due to its nature as a small membrane protein. Here's a methodological approach to address these challenges:

  • Protein expression and purification challenges:

    • Challenge: Low expression yields and protein instability

    • Solution: Optimize expression using specialized vectors (e.g., pET with pelB leader sequence) and host strains (e.g., C41(DE3) designed for membrane protein expression)

    • Approach: Screen multiple fusion tags (His, MBP, SUMO) and expression conditions (temperature, inducer concentration, duration)

    • Purification strategy: Use a two-step approach combining affinity chromatography and size exclusion chromatography with specialized detergents (DDM, LMNG) to maintain stability

  • Detergent selection for membrane protein stabilization:

    • Challenge: Finding suitable detergents that maintain protein structure while enabling structural studies

    • Solution: Perform systematic detergent screening

    • Method: Use thermal shift assays with CPM (7-Diethylamino-3-(4'-Maleimidylphenyl)-4-Methylcoumarin) to evaluate protein stability in different detergents

    • Alternatives: Consider novel approaches like nanodiscs, SMALPs (Styrene-Maleic Acid Lipid Particles), or amphipols for detergent-free stabilization

  • Crystallization difficulties:

    • Challenge: Small membrane proteins often resist crystallization

    • Solutions:

      • Use lipidic cubic phase (LCP) crystallization specifically designed for membrane proteins

      • Generate antibody fragments (Fab) or nanobodies to increase polar surface area

      • Create fusion constructs with crystallization chaperones (e.g., T4 lysozyme)

      • Implement high-throughput crystallization screening with specialized membrane protein screens

  • NMR spectroscopy approach:

    • Challenge: Signal overlap in traditional NMR due to protein size and detergent micelles

    • Solution: Employ specialized NMR techniques for membrane proteins

    • Methods: Use selective isotope labeling (15N, 13C, 2H) and TROSY (Transverse Relaxation-Optimized Spectroscopy) experiments

    • Sample preparation: Optimize protein:detergent ratios and consider shorter chain detergents for NMR studies

  • Cryo-EM considerations:

    • Challenge: MdtJ's small size (~13 kDa) is below the typical detection limit for cryo-EM

    • Solutions:

      • Study the MdtJ-MdtI complex rather than individual proteins

      • Use Fab fragments or megabodies to increase particle size

      • Apply new techniques like microED (micro-electron diffraction) for small proteins

      • Consider scaffold proteins or fusion partners to increase molecular weight

  • Computational approaches:

    • Challenge: Experimental limitations may hinder complete structure determination

    • Complementary methods: Employ molecular dynamics simulations and homology modeling

    • Validation: Use crosslinking mass spectrometry to validate predicted structural models

    • Integration: Combine low-resolution experimental data with computational predictions

By systematically addressing these challenges using the described methodological approaches, researchers can make significant progress in elucidating the structure of MdtJ, which would provide valuable insights into its function and interaction mechanisms .

How do post-translational modifications affect MdtJ function and stability?

While post-translational modifications (PTMs) of MdtJ have not been extensively characterized in the literature, a methodological framework for investigating their impact on function and stability would include:

  • Identification of potential PTMs:

    • Perform mass spectrometry analysis of purified native MdtJ from S. paratyphi C

    • Use enrichment strategies for specific modifications (phosphopeptide enrichment, etc.)

    • Apply targeted proteomics approaches such as multiple reaction monitoring (MRM)

    • Compare PTM profiles between different growth conditions, especially those mimicking host environments

  • Site-directed mutagenesis of modified residues:

    • Generate alanine substitutions at identified modification sites

    • Create phosphomimetic mutations (Ser/Thr to Asp/Glu) or non-phosphorylatable mutations (Ser/Thr to Ala)

    • Compare protein stability using thermal shift assays and circular dichroism spectroscopy

    • Assess functional impact using spermidine export assays described in section 2.3

  • Regulatory enzymes identification:

    • Conduct pull-down experiments to identify kinases, phosphatases, or other enzymes that interact with MdtJ

    • Perform in vitro modification assays with purified enzymes and MdtJ

    • Use chemical inhibitors of specific modification enzymes to assess their impact on MdtJ function in vivo

  • Temporal dynamics of modifications:

    • Monitor changes in PTM patterns during different growth phases

    • Assess modifications in response to spermidine exposure or stress conditions

    • Develop fluorescent reporters linked to MdtJ modification states

  • Structural impact assessment:

    • Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to compare structural dynamics between modified and unmodified forms

    • Perform molecular dynamics simulations to predict how specific modifications affect protein conformation

    • Integrate findings with transport activity data to establish structure-function relationships

  • Physiological relevance testing:

    • Create S. paratyphi C strains expressing only non-modifiable MdtJ variants

    • Assess impact on bacterial growth, stress response, and virulence

    • Compare polyamine homeostasis in these strains with wild-type bacteria

This methodological framework would provide comprehensive insights into how PTMs regulate MdtJ function and stability, potentially revealing new mechanisms for controlling spermidine export during infection and stress responses.

How can MdtJ research contribute to understanding Salmonella host adaptation mechanisms?

MdtJ research provides a valuable model for understanding broader Salmonella host adaptation mechanisms through several methodological approaches:

  • Comparative genomics and evolution:

    • Compare mdtJ sequences across Salmonella serovars with different host preferences

    • Analyze selective pressure on mdtJ using dN/dS ratios during host adaptation

    • Integrate findings with genome-wide analyses of divergence and convergence patterns

    This approach has already revealed that S. paratyphi C likely diverged from a common ancestor with S. choleraesuis (primarily a swine pathogen) by accumulating genomic changes during adaptation to humans, with greater non-synonymous than synonymous substitutions suggesting positive selection during this process .

  • Polyamine metabolism as an adaptation mechanism:

    • Compare spermidine export capacities between host-restricted and broad-host-range serovars

    • Investigate how host-specific polyamine environments shape bacterial adaptation

    • Analyze regulation of mdtJ expression in response to host-specific signals

  • Integration with pathogenicity island analysis:

    • Examine co-evolution of mdtJ with Salmonella pathogenicity islands

    • Study functional interplay between spermidine export and virulence determinants

    • Map evolutionary trajectories of metabolic and virulence genes during host adaptation

  • Experimental evolution approaches:

    • Design laboratory evolution experiments under host-mimicking conditions

    • Monitor changes in mdtJ sequence, expression, and function during adaptation

    • Test evolved strains in relevant infection models to validate adaptation signatures

  • Host response analysis:

    • Investigate how MdtJ-mediated polyamine export affects host immune responses

    • Compare host metabolic changes induced by wild-type bacteria versus mdtJ mutants

    • Assess whether polyamine modulation by MdtJ contributes to immune evasion

  • Network analysis:

    • Construct interaction networks integrating MdtJ with other proteins involved in host adaptation

    • Apply systems biology approaches to identify key nodes in adaptation networks

    • Develop predictive models for host adaptation based on molecular signatures

The significance of this research extends beyond MdtJ itself, as it provides a framework for understanding how relatively subtle molecular changes in conserved proteins can contribute to major shifts in host range and pathogenic potential. The divergence of S. paratyphi C from S. choleraesuis represents an excellent model system for studying the genetic basis of host adaptation in bacterial pathogens .

What insights from MdtJ research could inform antimicrobial development strategies?

MdtJ research offers several methodological pathways to inform novel antimicrobial development strategies:

  • Targeting spermidine export as a virulence attenuation strategy:

    • Develop high-throughput screening assays for MdtJ inhibitors

    • Design rational inhibitors based on structural studies of the MdtJ-MdtI complex

    • Evaluate how inhibiting spermidine export affects bacterial survival in host environments

    This approach is supported by evidence that polyamine homeostasis is critical for bacterial growth and virulence, and disruption of this balance could potentially attenuate pathogenicity .

  • Exploiting species-specific differences in MdtJ:

    • Identify S. paratyphi C-specific residues or structural features in MdtJ

    • Design selective inhibitors that target typhoid-causing Salmonella species

    • Develop narrow-spectrum antimicrobials with reduced impact on commensal bacteria

  • Metabolomic-guided drug discovery:

    • Analyze metabolite changes in host cells and bacteria during infection

    • Identify metabolic vulnerabilities linked to polyamine transport

    • Design combination therapies targeting multiple aspects of polyamine metabolism

    This strategy builds on metabolomic profiling studies that have identified serovar-specific metabolite signatures during Salmonella infections .

  • Adjuvant development:

    • Investigate whether MdtJ inhibitors could enhance efficacy of existing antibiotics

    • Test combinations of polyamine transport inhibitors with conventional antimicrobials

    • Design delivery systems that target polyamine-rich microenvironments

  • Resistance mechanism studies:

    • Characterize potential resistance mechanisms against MdtJ inhibitors

    • Identify evolutionary constraints that might limit resistance development

    • Design inhibitor strategies accounting for possible resistance pathways

  • Translational research pathway:

    • Develop cell-based models to test MdtJ inhibitor efficacy

    • Establish animal models for in vivo validation

    • Design clinical trials with appropriate biomarkers for efficacy assessment

    The methodological framework should include:

    Research PhaseKey MethodsExpected Outcomes
    Target validationGene knockout studies, animal infection modelsConfirmation of MdtJ as a viable therapeutic target
    Inhibitor screeningHigh-throughput assays, in silico screeningIdentification of lead compounds
    Lead optimizationMedicinal chemistry, structure-activity relationship studiesDevelopment of potent and selective inhibitors
    Preclinical testingADME-Tox studies, animal efficacy modelsSelection of clinical candidates
    Clinical developmentBiomarker development, patient stratification strategiesTranslation to human therapeutics

This research direction offers the potential for novel antimicrobial strategies that target pathogen-specific vulnerabilities rather than broadly conserved functions, potentially reducing selective pressure for resistance development .

How can systems biology approaches integrate MdtJ function into broader cellular networks?

Systems biology approaches offer powerful methodologies to integrate MdtJ function into broader cellular networks, providing holistic understanding of its role in S. paratyphi C physiology and pathogenesis:

  • Flux balance analysis:

    • Develop a genome-scale metabolic model for S. paratyphi C

    • Incorporate polyamine metabolism and transport reactions

    • Simulate the impact of mdtJ deletion on metabolic flux distributions

    • Predict synthetic lethal interactions with mdtJ under various conditions

  • Protein-protein interaction networks:

    • Perform affinity purification-mass spectrometry (AP-MS) to identify MdtJ interaction partners

    • Map these interactions onto the broader protein interaction network

    • Identify hub proteins and network modules connected to MdtJ

    • Validate key interactions using techniques like FRET or BRET

  • Regulatory network analysis:

    • Identify transcription factors that regulate mdtJ expression

    • Map polyamine-responsive regulatory elements in the mdtJ promoter

    • Perform ChIP-seq to identify genome-wide binding sites of these regulators

    • Construct hierarchical regulatory networks governing polyamine homeostasis

  • Host-pathogen interaction mapping:

    • Profile host cell responses to wild-type and mdtJ mutant infection

    • Identify host pathways affected by MdtJ-mediated polyamine export

    • Construct interspecies interaction networks

    • Apply machine learning to predict key nodes in host-pathogen networks

  • Dynamic modeling:

    • Develop ordinary differential equation (ODE) models of polyamine metabolism

    • Incorporate MdtJ-mediated export into these models

    • Simulate system behavior under various perturbations

    • Validate model predictions experimentally

These systems biology approaches would place MdtJ within its functional context, revealing how this transporter contributes to broader cellular functions and host interactions. The resulting integrated network would provide a framework for understanding polyamine homeostasis in the context of Salmonella pathogenesis and identifying potential intervention points for therapeutic development .

What emerging technologies could advance our understanding of MdtJ biology?

Several emerging technologies hold promise for advancing our understanding of MdtJ biology, offering new methodological approaches for researchers:

  • CryoET and in situ structural biology:

    • Apply cryo-electron tomography to visualize MdtJ-MdtI complexes in their native membrane environment

    • Use correlative light and electron microscopy (CLEM) to track MdtJ localization during infection

    • Implement focused ion beam milling to enable visualization in intact bacterial cells

    • These approaches would reveal the true structural organization of MdtJ beyond traditional purified protein studies

  • Single-molecule transport assays:

    • Develop fluorescent spermidine analogs to track transport in real-time

    • Apply total internal reflection fluorescence (TIRF) microscopy to monitor single-molecule transport events

    • Use microfluidic devices to precisely control substrate concentrations

    • These methods would provide unprecedented insights into transport kinetics and mechanisms

  • CRISPR-based technologies:

    • Apply CRISPR interference (CRISPRi) for tunable repression of mdtJ

    • Use CRISPR activation (CRISPRa) to enhance expression in specific conditions

    • Implement CRISPR screens to identify genetic interactions with mdtJ

    • These approaches would enable precise manipulation of MdtJ expression and function

  • Advanced imaging techniques:

    • Use super-resolution microscopy (STORM/PALM) to visualize MdtJ distribution in membranes

    • Apply expansion microscopy to enhance visualization of membrane protein organization

    • Implement live-cell imaging with tagged MdtJ to track dynamics during infection

    • These techniques would reveal spatial organization and dynamics beyond conventional microscopy limits

  • Synthetic biology approaches:

    • Design synthetic circuits to control mdtJ expression in response to specific signals

    • Create chimeric transporters by domain swapping between MdtJ variants

    • Develop synthetic polyamine analogs to probe transport specificity

    • These methods would enable precise manipulation of MdtJ function and testing of mechanistic hypotheses

  • AI-driven protein engineering:

    • Apply deep learning algorithms (like AlphaFold) to predict MdtJ structure with high confidence

    • Use machine learning to design MdtJ variants with altered specificity or activity

    • Develop computational models to predict effects of mutations on transport function

    • These computational approaches would accelerate experimental design and hypothesis generation

By integrating these emerging technologies into MdtJ research, scientists can overcome current limitations and gain deeper insights into the structural, functional, and regulatory aspects of this important transporter, ultimately contributing to our understanding of Salmonella pathogenesis and polyamine homeostasis.

What are the most promising interdisciplinary approaches for studying MdtJ in the context of host-pathogen interactions?

Interdisciplinary approaches offer powerful frameworks for studying MdtJ in host-pathogen interactions, combining methodologies from multiple fields:

  • Integrating structural biology with infection biology:

    • Apply native mass spectrometry to identify MdtJ interaction partners during infection

    • Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes in MdtJ under host conditions

    • Implement in-cell NMR to study MdtJ structure in living bacteria during infection

    This integration would connect molecular structure with function in biologically relevant contexts.

  • Combining microfluidics with live-cell imaging:

    • Design microfluidic devices that mimic host microenvironments

    • Incorporate fluorescently tagged MdtJ and host cell markers

    • Apply time-lapse microscopy to track MdtJ dynamics during host-pathogen interactions

    • This approach would provide spatial and temporal resolution of MdtJ function during infection

  • Merging immunology with bacterial genetics:

    • Profile host immune responses to wild-type and mdtJ mutant Salmonella

    • Use cytokine profiling, immune cell phenotyping, and transcriptomics

    • Apply systems immunology approaches to identify MdtJ-dependent immune signatures

    • This interdisciplinary approach would reveal connections between bacterial polyamine export and host immunity

  • Integrating metabolomics with mathematical modeling:

    • Perform untargeted metabolomics on host-pathogen interfaces

    • Develop mathematical models of polyamine flux between host and pathogen

    • Create predictive models of how MdtJ activity shapes the infection metabolome

    • This approach would quantitatively describe the metabolic dialogue between host and pathogen

  • Combining synthetic biology with organoid technology:

    • Engineer Salmonella strains with controllable mdtJ expression

    • Infect human intestinal organoids to study host-pathogen interactions

    • Apply spatial transcriptomics to map responses in different organoid regions

    • This integration would provide physiologically relevant models for studying MdtJ function

  • Merging evolutionary biology with functional genomics:

    • Trace the evolutionary history of mdtJ across Salmonella lineages

    • Correlate sequence changes with host adaptation events

    • Apply ancestral sequence reconstruction to test historical MdtJ variants

    • This approach would connect molecular evolution to functional adaptation

The implementation framework should include:

  • Establishment of interdisciplinary research teams with expertise across relevant fields

  • Development of shared experimental platforms and data integration pipelines

  • Adoption of common standards for data collection and analysis

  • Implementation of collaborative project management structures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.