Recombinant Salmonella paratyphi C Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Protein Structure

  • Gene Origin: uppP is derived from Salmonella Paratyphi C strain RKS4594 (UniProt ID: C0PYX8) .

  • Amino Acid Sequence: Comprises 273 residues with the sequence:
    MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAVVVMFWRRLFGLIGIHFGRPLQREGESKGRLTLIHILLGMIPAVVLGLVFHDTIKSLFNPI NVMYTLVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGmLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSFLTAADIPMFAVGFVTAFVVALIAIKTFLQLIKRISFIPFAIYRFVVAAAVYVVFF .

  • Post-Translational Modifications: Produced with an N-terminal His-tag for purification, expressed in E. coli, yeast, or mammalian systems .

Biochemical Properties

ParameterValue
Molecular Weight~30 kDa (calculated)
EC Number3.6.1.27
Optimal pH7.0–8.0 (Tris-based buffer)
Storage Conditions-20°C (short-term), -80°C (long-term)
Purity>90% (SDS-PAGE verified)
StabilityAvoid repeated freeze-thaw cycles

Biological Significance

  • Cell Wall Biosynthesis: uppP recycles UP, a lipid carrier essential for synthesizing peptidoglycan and O-antigen polysaccharides .

  • Antibiotic Resistance: Overexpression confers bacitracin resistance by maintaining UP pools critical for cell wall repair .

  • Pathogenicity Link: Deletion of uppP disrupts O-antigen ligation, reducing virulence in Salmonella .

Mechanism of Action

uppP hydrolyzes UPP (C55-PP) to UP (C55-P) via a magnesium-dependent reaction:
UPP+H2OUP+Pi\text{UPP} + \text{H}_2\text{O} \rightarrow \text{UP} + \text{P}_i
This reaction regenerates UP for ongoing glycan chain assembly .

Vaccine Development

  • Conjugate Vaccine Targets: O-antigen polysaccharides dependent on UP require functional uppP for biosynthesis .

  • Bactericidal Assays: Anti-uppP antibodies show cross-reactive bactericidal activity against multiple S. Paratyphi strains .

Antibiotic Discovery

  • High-Throughput Screening: Recombinant uppP is used to identify inhibitors targeting undecaprenyl metabolism .

  • Bacitracin Synergy: Knockdown studies validate uppP as a target for adjuvant therapies .

Genomic Context in S. Paratyphi C

  • Chromosomal Location: Part of a highly conserved operon near SPI-7, a pathogenicity island .

  • Evolutionary Divergence: Shares 89% sequence identity with S. Choleraesuis uppP, reflecting recent host adaptation .

Pseudogenization in Typhoid Strains

  • Unlike S. Typhi and S. Paratyphi A, S. Paratyphi C retains functional uppP, suggesting divergent evolutionary strategies for host niche adaptation .

Challenges and Future Directions

  • Structural Studies: No crystallographic data exists for Salmonella uppP, limiting mechanistic insights.

  • In Vivo Validation: Role in systemic infection remains underexplored outside enteric fever models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
uppP; SPC_3281; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
uppP
Target Protein Sequence
MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQREGESKGRLTLIHILLGMIPAVVLGLVFHDTIKSLFNPI NVMYTLVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSFLTAADIPMFAVGFVTAFVVALI AIKTFLQLIKRISFIPFAIYRFVVAAAVYVVFF
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: sei:SPC_3281

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the enzymatic classification of Salmonella paratyphi C uppP?

Salmonella paratyphi C undecaprenyl-diphosphatase (uppP) is classified as EC 3.6.1.27 and is also known as bacitracin resistance protein or undecaprenyl pyrophosphate phosphatase. The enzyme functions in bacterial cell wall synthesis by catalyzing the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, a critical carrier lipid in peptidoglycan assembly. In S. paratyphi C strain RKS4594, the protein consists of 273 amino acids and possesses multiple transmembrane domains consistent with its role in membrane-associated processes .

What is the predicted membrane topology of uppP?

Based on the amino acid sequence, uppP is predicted to be an integral membrane protein with multiple transmembrane domains. The protein contains hydrophobic regions consistent with membrane-spanning segments, which position the active site to access both cytoplasmic and periplasmic compartments. This topology is crucial for its function in processing undecaprenyl pyrophosphate at the cytoplasmic face of the membrane and subsequently facilitating the translocation of undecaprenyl phosphate for peptidoglycan synthesis .

How does S. paratyphi C uppP reflect evolutionary adaptation to human hosts?

The uppP gene in S. paratyphi C represents an interesting case study in pathogen adaptation. Genomic analysis indicates that S. paratyphi C has diverged from a common ancestor with S. choleraesuis relatively recently, with evidence of strong selection pressure during adaptation to human hosts. The differential nucleotide substitutions in genes including uppP suggest adaptive evolution facilitating the transition from primarily swine pathogenesis (S. choleraesuis) to human-adapted typhoid pathogenesis (S. paratyphi C) .

The dN/dS ratio (non-synonymous to synonymous substitution rate) between S. paratyphi C and S. choleraesuis shows greater non-synonymous changes, indicating positive selection that likely contributed to host adaptation. These molecular signatures in uppP and other genes reflect the genomic changes necessary for adaptation to the human environment and the convergent evolution toward typhoid pathogenesis .

What is the genomic relationship between S. paratyphi C and other typhoid-causing Salmonella?

Comparative genomic analysis demonstrates that S. paratyphi C does not share a common immediate ancestor with other human-adapted typhoid agents like S. typhi. Instead, phylogenetic analysis of 3691 shared genes across sequenced Salmonella strains places S. paratyphi C and S. choleraesuis together at one end of the phylogenetic tree, with S. typhi at the opposite end .

This genomic evidence strongly supports a convergent evolution model of typhoid pathogenesis, wherein S. paratyphi C and S. typhi independently acquired similar pathogenic traits. S. paratyphi C shares 4346 genes with S. choleraesuis but only 4008 genes with S. typhi, further supporting their distinct evolutionary histories despite causing similar clinical syndromes in humans .

How does gene conservation of uppP compare across different Salmonella serovars?

This conservation suggests that uppP function remains critical regardless of host specialization, unlike some virulence-associated genes that may be inactivated during adaptation to specific host environments. The gene is identified as SPC_3281 in the S. paratyphi C genome and SPA3073 in S. paratyphi A, with synonyms including bacA in some annotation systems .

What are the optimal expression systems for producing recombinant S. paratyphi C uppP?

For successful expression of recombinant S. paratyphi C uppP, researchers should consider several systems based on the protein's characteristics:

For functional studies, expression constructs should encompass the full-length protein (amino acids 1-273) to maintain native enzymatic activity. Protein expression should be verified through Western blotting and activity assays to confirm proper folding and function .

What storage conditions are recommended for maintaining recombinant S. paratyphi C uppP stability?

Optimal storage conditions for recombinant S. paratyphi C uppP include:

  • Short-term storage: Maintain working aliquots at 4°C for up to one week in a Tris-based buffer with 50% glycerol optimized for this specific protein.

  • Long-term storage: Store at -20°C, with extended storage preferably at -80°C to maintain stability and prevent degradation.

  • Handling precautions: Repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of enzymatic activity. Creating multiple small working aliquots during initial preparation is recommended .

The inclusion of glycerol (50%) in the storage buffer is critical for maintaining protein stability and preventing aggregation during freeze-thaw cycles. For functional assays, researchers should consider buffer exchange to remove glycerol if it interferes with downstream applications .

What analytical methods are recommended for assessing uppP enzymatic activity?

To assess the enzymatic activity of recombinant S. paratyphi C uppP, researchers should consider these methodological approaches:

  • Radiometric assays: Using radiolabeled undecaprenyl pyrophosphate substrates to directly measure dephosphorylation products via thin-layer chromatography or HPLC.

  • Colorimetric phosphate detection: Measuring released inorganic phosphate using molybdate-based colorimetric assays such as malachite green.

  • Coupled enzyme assays: Linking uppP activity to secondary enzymatic reactions with measurable outputs.

  • Bacitracin resistance assays: As uppP confers bacitracin resistance, functional complementation of uppP-deficient strains can serve as an indirect measure of activity.

When designing these assays, researchers should incorporate appropriate controls including heat-inactivated enzyme, reaction mixtures without enzyme, and if available, known inhibitors of uppP to validate specificity. Detergent selection is critical when working with membrane proteins like uppP, and optimization may be required to maintain both solubility and activity .

How does uppP contribute to S. paratyphi C pathogenesis?

The contribution of uppP to S. paratyphi C pathogenesis is multifaceted:

  • Cell wall integrity: As an undecaprenyl pyrophosphate phosphatase, uppP plays a critical role in peptidoglycan synthesis and cell wall integrity, which is fundamental for bacterial survival during infection.

  • Antimicrobial resistance: uppP (also known as bacA) contributes to resistance against bacitracin and potentially other antimicrobial compounds targeting cell wall synthesis, enhancing bacterial survival under selective pressure.

  • Host adaptation: The subtle sequence variations in uppP between Salmonella strains may contribute to the adaptation to specific host environments. The positive selection observed in genes during S. paratyphi C adaptation to humans suggests that these changes may have functional significance in pathogenesis .

What distinct genetic features differentiate S. paratyphi C from other typhoid-causing Salmonella?

S. paratyphi C exhibits several distinct genetic features that differentiate it from other typhoid-causing Salmonella:

  • Genomic content: S. paratyphi C RKS4594 possesses a chromosome of 4,833,080 bp and a plasmid of 55,414 bp. It contains 4,640 intact coding sequences (4,578 in the chromosome and 62 in the plasmid) and 152 pseudogenes (149 in the chromosome and 3 in the plasmid) .

  • Evolutionary relationship: S. paratyphi C shows greater genomic similarity to S. choleraesuis (sharing 4346 genes) than to S. typhi (sharing only 4008 genes), despite both S. paratyphi C and S. typhi causing typhoid fever in humans .

  • Virulence plasmid: S. paratyphi C contains a virulence plasmid (pSPCV) that shares high sequence identity with the virulence plasmids of S. typhimurium (pSLT) and S. choleraesuis (pKDSC50), though with evidence of gradual degradation and gene loss during evolution .

  • Pseudogene patterns: The pattern of pseudogenes in S. paratyphi C differs from those in S. typhi, reflecting independent evolutionary paths toward human adaptation and typhoid pathogenesis .

These genetic distinctions support a model where S. paratyphi C and other typhoid agents like S. typhi evolved independently to cause similar diseases through convergent evolution rather than diverging from a common typhoid-causing ancestor .

How might the enzymatic activity of uppP be targeted for therapeutic development?

The enzymatic activity of uppP presents several opportunities for therapeutic development:

  • Inhibitor design: As uppP is essential for bacterial cell wall synthesis, specific inhibitors could disrupt bacterial growth. Structure-based drug design targeting the active site could yield novel antibacterial compounds.

  • Combination therapies: uppP inhibitors could potentially synergize with existing antibiotics, particularly those targeting cell wall synthesis, to enhance efficacy or overcome resistance mechanisms.

  • Host-specificity considerations: The subtle sequence differences in uppP between human-adapted and animal-adapted Salmonella strains could potentially be exploited to develop therapeutics with specificity for human pathogens.

  • Vaccine development: Recombinant uppP could potentially serve as a component in subunit vaccine formulations, though its membrane-associated nature and conservation across bacterial species would necessitate careful epitope selection and adjuvant optimization.

When developing such approaches, researchers must consider the conservation of undecaprenyl pyrophosphate phosphatases across bacterial species to balance broad-spectrum activity against potential impacts on commensal microbiota .

How can metabolomic approaches incorporate uppP analysis in Salmonella infection studies?

Integrating uppP analysis into metabolomic studies of Salmonella infection provides several research opportunities:

  • Lipid carrier pool analysis: Quantitative analysis of undecaprenyl phosphate and pyrophosphate levels in wild-type versus uppP mutant strains can elucidate the enzyme's contribution to cell wall precursor homeostasis during infection.

  • Metabolite profile comparison: As demonstrated with S. Typhi and S. Paratyphi A infections, distinct metabolite profiles can be identified using techniques like two-dimensional gas chromatography with time-of-flight mass spectrometry (GCxGC/TOFMS). Similar approaches could be applied to investigate whether uppP activity influences host or bacterial metabolite signatures .

  • In vivo pathway flux analysis: Stable isotope labeling combined with metabolomics could track the flow of metabolites through pathways dependent on uppP activity during infection.

  • Biomarker discovery: Altered uppP function may generate specific metabolite signatures that could serve as diagnostic biomarkers, similar to the approach that identified 695 individual metabolite peaks distinguishing S. Typhi and S. Paratyphi A infections .

These metabolomic approaches could reveal how uppP activity influences both bacterial physiology and host response during infection, potentially identifying novel diagnostic markers or therapeutic targets .

What comparative structural biology approaches would be most informative for studying uppP across Salmonella serovars?

To gain insights into uppP structure-function relationships across Salmonella serovars, researchers should consider these comparative structural biology approaches:

  • Homology modeling and molecular dynamics: Using available bacterial phosphatase structures as templates to model uppP from different Salmonella serovars, followed by molecular dynamics simulations to identify strain-specific structural dynamics.

  • Site-directed mutagenesis of variant residues: Creating point mutations at positions that vary between S. paratyphi C and other serovars (e.g., position 62 R/Q and position 128 T/A differences between S. paratyphi C and S. paratyphi A) to assess functional consequences.

  • Protein crystallography or cryo-EM: While challenging for membrane proteins, structural determination of uppP from multiple serovars would provide definitive comparative data. Detergent screening or lipidic cubic phase crystallization may facilitate membrane protein structure determination.

  • Hydrogen-deuterium exchange mass spectrometry: This technique can provide insights into protein dynamics and ligand interactions without requiring crystallization, potentially revealing strain-specific differences in protein flexibility or substrate binding.

These approaches could illuminate how subtle sequence variations influence protein structure and function, potentially explaining serovar-specific adaptations to different host environments .

How might CRISPR-Cas9 genome editing be applied to study uppP function in Salmonella pathogenesis?

CRISPR-Cas9 genome editing offers powerful approaches to study uppP function in Salmonella pathogenesis:

  • Precise gene knockout: Creating clean uppP deletion mutants without polar effects on neighboring genes to assess the role in virulence and cell wall homeostasis.

  • Point mutation introduction: Introducing specific amino acid substitutions to test hypotheses about key residues or to convert the sequence of one serovar to match another (e.g., changing S. paratyphi C residues to match S. typhi) to assess functional consequences.

  • Promoter modifications: Modulating uppP expression levels through promoter engineering to determine dose-dependent effects on cell wall synthesis and antimicrobial resistance.

  • Reporter fusions: Creating translational fusions with fluorescent proteins to monitor uppP expression and localization under various infection-relevant conditions.

  • CRISPRi approaches: Using catalytically inactive Cas9 (dCas9) to modulate uppP expression without genetic modification, allowing titration of expression levels.

When applying these techniques to S. paratyphi C, researchers must consider the human-restricted nature of this pathogen, which limits in vivo model systems. Cell culture infection models, humanized mouse models, or comparative studies with broad-host-range Salmonella strains carrying S. paratyphi C uppP variants would help overcome these limitations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.