Recombinant Salmonella paratyphi C Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; SPC_1413; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
arnC
Target Protein Sequence
MFDAAPIKKVSVVIPVYNEQESLPELIRRTTTACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAISGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTPFTEESHQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A and is essential for resistance to polymyxin and cationic antimicrobial peptides.

Database Links

KEGG: sei:SPC_1413

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of arnC in Salmonella paratyphi C pathogenesis?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) plays a critical role in lipopolysaccharide (LPS) modification in Salmonella paratyphi C. This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) to undecaprenyl phosphate, which is a crucial step in the modification of lipid A .

The modification of lipid A alters the bacterial cell surface charge, reducing the binding affinity of cationic antimicrobial peptides (CAMPs) produced by the host immune system. This modification is essential for Salmonella paratyphi C to survive in the human host environment, particularly during systemic infection where it encounters various host defense mechanisms .

Research has shown that arnC is part of the arnBCADTEF operon, which is activated under conditions that mimic the host environment (low pH, low Mg²⁺) through the PhoP/PhoQ and PmrA/PmrB two-component regulatory systems. This activation contributes significantly to the bacterium's ability to cause typhoid fever, a potentially fatal systemic infection .

How is the genetic structure of arnC conserved across different Salmonella serovars?

The arnC gene shows high conservation across different Salmonella serovars, but with subtle sequence variations that may reflect host adaptation. Based on genetic analysis, the following patterns have been observed:

Salmonella SerovararnC Length (aa)Sequence Similarity to S. paratyphi C arnCNotable Amino Acid Differences
S. paratyphi C327100% (reference)-
S. paratyphi B327~99%Different residue at position 191 (G instead of S)
S. choleraesuis327~99%Highly conserved with S. paratyphi C
S. typhi327~97%Multiple substitutions reflecting divergent evolution

Genomic comparison studies have revealed that S. paratyphi C shares as many as 4,346 genes with S. choleraesuis (primarily a swine pathogen), but only 4,008 genes with S. typhi (another human-adapted typhoid agent). This indicates that S. paratyphi C is more closely related to S. choleraesuis and has evolved independently from S. typhi, despite causing similar disease manifestations in humans .

The conservation of arnC across these serovars highlights its essential function, while the subtle variations may contribute to host adaptation and pathogenic mechanisms specific to each serovar .

Basic Approaches:

  • Recombinant Protein Expression: Using E. coli expression systems with His-tags for protein purification as demonstrated in available commercial products .

  • Enzymatic Activity Assays: Measuring the transfer of Ara4FN to undecaprenyl phosphate using radioactive or fluorescent-labeled substrates.

Advanced Approaches:

  • Site-Directed Mutagenesis: Creating specific mutations in the arnC gene to identify critical residues for enzyme function.

  • Crystallography and Structural Analysis: Determining the three-dimensional structure of arnC to understand substrate binding and catalytic mechanisms.

  • In vitro Reconstitution Assays: Reconstructing the complete LPS modification pathway with purified components including arnC to measure activity rates and substrate specificity.

Suggested Experimental Protocol:

  • Express recombinant arnC with N-terminal His-tag in E. coli .

  • Purify using Ni-NTA affinity chromatography in a buffer containing Tris-PBS with 6% trehalose at pH 8.0 .

  • Perform enzymatic assays using undecaprenyl phosphate substrate and labeled Ara4FN.

  • Analyze reaction products by thin-layer chromatography or HPLC.

  • Conduct kinetic studies to determine Km and Vmax values for different substrates.

This approach allows for detailed biochemical characterization of arnC activity and provides a foundation for inhibitor screening .

Mouse Models:

Findings on arnC and Virulence:

  • Mutations in arnC and related genes in the arnBCADTEF operon result in increased sensitivity to antimicrobial peptides and reduced survival in macrophages.

  • The arnC pathway is essential for full virulence, as demonstrated in related Salmonella serovars.

  • Expression of arnC is upregulated during infection, particularly in environments mimicking intracellular conditions.

Correlation with Clinical Data:

  • The modification of LPS through the arnC pathway contributes to persistent infection and bacterial survival in human hosts.

  • Patient blood cultures have demonstrated consistent expression of LPS modifications mediated by arnC and related enzymes .

These findings highlight the importance of arnC in S. paratyphi C pathogenesis, although direct studies in appropriate animal models remain challenging due to the human-restricted nature of this pathogen .

How do arnC-mediated LPS modifications affect antibiotic resistance in Salmonella paratyphi C?

The LPS modifications catalyzed by arnC significantly impact antibiotic resistance in Salmonella paratyphi C through several mechanisms:

Resistance Mechanisms:

  • Polymyxin Resistance: Addition of Ara4FN to lipid A reduces the negative charge of the outer membrane, decreasing the binding affinity of polymyxins and other cationic antimicrobial peptides.

  • Barrier Function Enhancement: Modified LPS alters membrane permeability, reducing the penetration of hydrophobic antibiotics.

  • Innate Immune Evasion: LPS modifications help bacteria evade host antimicrobial peptides, enabling persistence during infection.

Clinical Significance:

Increasing antibiotic resistance in Salmonella paratyphi has been reported, including:

  • Reduced susceptibility to fluoroquinolones (MIC 0.25-1.0 mg/liter) by the early 1990s

  • High prevalence of ciprofloxacin resistance (84% of isolates in 2004)

  • Emerging resistance to azithromycin, with reported treatment failures

Resistance Profile Comparison:

AntibioticS. paratyphi A with active arnCS. paratyphi A with impaired arnCClinical Impact
CiprofloxacinMIC 0.5-2.0 mg/literLower MICTreatment failures despite apparent susceptibility by disk testing
AzithromycinEmerging resistance (MIC 64-256 mg/liter)Increased susceptibilityAlternative treatment option now threatened
CeftriaxoneGenerally susceptible (MIC 0.125-0.5 mg/liter)Similar susceptibilityCurrently effective treatment option

Understanding the role of arnC in antibiotic resistance has important implications for treatment strategies and the development of new antimicrobial agents targeting this pathway .

What are the structural and functional differences in arnC between Salmonella paratyphi C and other Salmonella serovars?

Comparative analysis reveals subtle but potentially significant differences in arnC structure and function across Salmonella serovars:

Amino Acid Sequence Comparison:

Examination of the full-length sequences shows:

  • S. paratyphi C arnC (327aa): Contains isoleucine at position 191 (SVIAISG)

  • S. paratyphi B arnC (327aa): Contains glycine at position 191 (SVIAGG)

  • Both maintain the essential catalytic domains and transmembrane regions

Functional Implications:

The amino acid substitutions occur primarily in:

  • Transmembrane regions - potentially affecting membrane insertion and stability

  • Substrate binding pocket - possibly altering substrate specificity or catalytic efficiency

  • Protein-protein interaction domains - potentially modifying interactions with other enzymes in the LPS modification pathway

Evolutionary Context:

Phylogenetic analysis based on 3,691 shared genes places:

  • S. paratyphi C and S. choleraesuis together at one end of the evolutionary tree

  • S. typhi at the opposite end

  • This indicates separate ancestries of these human-adapted typhoid agents despite causing similar diseases

These differences likely reflect the evolutionary pressures experienced during host adaptation, with S. paratyphi C showing evidence of "enormous selection pressures during its adaptation to man" as indicated by differential nucleotide substitutions and pseudogene patterns .

What methodologies are most effective for detecting arnC expression during Salmonella paratyphi C infection?

Detecting arnC expression during actual infection requires specialized approaches due to the challenges of studying host-restricted pathogens like Salmonella paratyphi C:

Transcriptional Analysis Methods:

  • RT-qPCR: Quantification of arnC mRNA from infected tissues or cell cultures

    • Sensitivity: Can detect low copy numbers

    • Limitation: Requires careful normalization to reference genes

  • RNA-Seq: Global transcriptomic analysis

    • Advantage: Provides context of arnC expression within the entire transcriptome

    • Challenge: Requires sufficient bacterial RNA from infected samples

Protein Detection Methods:

  • Western Blotting: Using antibodies against recombinant arnC

    • Approach: Generate antibodies against purified recombinant arnC protein

    • Limitation: Cross-reactivity with host proteins must be controlled

  • Mass Spectrometry: Proteomic analysis of infected tissues

    • Advantage: Can identify post-translational modifications

    • Challenge: Requires sufficient protein abundance

In vivo Reporter Systems:

  • Fluorescent Protein Fusions: Creating arnC-GFP fusion constructs

    • Application: Visualizing expression in cell culture or tissue models

    • Limitation: May affect protein function

  • Luciferase Reporters: Placing the arnC promoter upstream of luciferase

    • Advantage: Highly sensitive for transcriptional activity measurement

    • Application: Can be used in animal infection models

Metabolic Labeling:

  • BONCAT (Bio-Orthogonal Non-Canonical Amino Acid Tagging):

    • Approach: Label newly synthesized bacterial proteins during infection

    • Advantage: Distinguishes bacterial proteins from host proteins

These methodologies can be combined to provide comprehensive data on arnC expression patterns during infection, offering insights into the temporal and spatial regulation of LPS modifications .

How can researchers effectively study the interaction between arnC and the host immune system?

Studying the interaction between arnC and the host immune system requires multidisciplinary approaches:

Immunological Assays:

  • Pattern Recognition Receptor (PRR) Binding Studies:

    • Compare binding of modified (arnC-dependent) and unmodified LPS to TLR4-MD2 complexes

    • Measure activation of downstream signaling cascades (NFκB, MAPK)

  • Cytokine Profiling:

    • Analyze cytokine production (IL-1β, IL-6, TNF-α, IL-10) in response to bacterial strains with wild-type vs. mutant arnC

    • Methods: ELISA, multiplex bead arrays, or RNA-Seq of host cells

Immune Cell Interaction Studies:

  • Macrophage Survival Assays:

    • Compare intracellular survival of wild-type vs. arnC-deficient strains

    • Analyze phagolysosomal fusion and bacterial killing mechanisms

  • Neutrophil Function Assessment:

    • Measure neutrophil extracellular trap (NET) formation

    • Quantify bacterial killing by neutrophils comparing strains with different LPS modifications

In vivo Approaches:

  • Serum Bactericidal Assays (SBA):

    • Use luminescence-based SBA to measure complement-mediated killing

    • Compare susceptibility of strains with different LPS modifications

  • Metabolomic Signatures:

    • Analyze host metabolic responses to infection using GCxGC/TOFMS

    • Identify metabolites like 2,4-dihydroxybutanoic acid, phenylalanine, and pipecolic acid that are elevated during infection

Experimental Design Considerations:

  • Include appropriate controls (arnC knockout, complemented strains)

  • Account for potential compensatory mechanisms in the bacterial strains

  • Consider the human-restricted nature of S. paratyphi C when interpreting results from animal models

These approaches provide insight into how arnC-mediated LPS modifications contribute to immune evasion and persistent infection .

What are the challenges in developing inhibitors targeting the arnC pathway for antimicrobial therapy?

Targeting arnC for antimicrobial therapy presents several unique challenges and opportunities:

Target Validation Challenges:

  • Essentiality Assessment:

    • arnC is not essential for growth in standard laboratory conditions

    • Becomes critical only under specific stresses like antimicrobial peptide exposure

    • Challenge: Determining appropriate screening conditions that reflect in vivo relevance

  • Redundancy in LPS Modification Pathways:

    • Multiple mechanisms for LPS modification may compensate for arnC inhibition

    • Requires systems biology approach to identify synergistic targets

Drug Development Challenges:

  • Substrate Complexity:

    • Undecaprenyl phosphate and Ara4FN are complex substrates

    • Designing compounds that mimic these structures while maintaining drug-like properties is difficult

  • Membrane-Associated Target:

    • arnC is membrane-associated, making it difficult to access

    • Inhibitors must penetrate the outer membrane to reach their target

  • Structural Information Limitations:

    • Limited high-resolution structural data on arnC

    • Challenge in structure-based drug design approaches

Potential Screening Approaches:

  • Biochemical Assays:

    • Using purified recombinant arnC

    • Measure transfer of labeled Ara4FN to undecaprenyl phosphate

  • Whole-Cell Phenotypic Screens:

    • Screen for compounds that sensitize bacteria to polymyxins or antimicrobial peptides

    • Secondary assays to confirm arnC as the target

  • Fragment-Based Approaches:

    • Identify small molecule fragments that bind to arnC

    • Optimize these fragments into lead compounds

Therapeutic Potential:

An effective arnC inhibitor could:

  • Restore sensitivity to existing antibiotics like polymyxins

  • Enhance clearance by host immune defenses

  • Be particularly valuable for treating multidrug-resistant infections

Despite these challenges, the increasing prevalence of drug-resistant Salmonella paratyphi makes arnC an attractive target for novel therapeutic approaches .

How can recombinant arnC be optimized for structural studies and drug screening assays?

Optimizing recombinant arnC production and purification is critical for structural studies and drug screening applications:

Expression System Optimization:

  • Host Selection:

    • E. coli BL21(DE3) is commonly used

    • Consider membrane protein-optimized strains like C41(DE3) or C43(DE3)

    • Codon optimization for rare codons in S. paratyphi C sequence

  • Expression Construct Design:

    • N-terminal His-tag (6-10 histidines) for purification

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Include precision protease sites for tag removal

  • Induction Conditions:

    • Low temperature induction (16-20°C)

    • Extended expression time (overnight)

    • IPTG concentration optimization (0.1-0.5 mM)

Purification Strategy:

  • Membrane Extraction:

    • Detergent screening (DDM, LDAO, LMNG)

    • Test both harsh (SDS, Triton X-100) and mild (DDM, CHAPS) detergents

  • Chromatography Steps:

    • Initial IMAC (Ni-NTA) purification

    • Secondary purification by size exclusion or ion exchange

    • Buffer optimization containing stabilizers (6% trehalose recommended)

  • Protein Quality Assessment:

    • SDS-PAGE for purity (>90% recommended)

    • Mass spectrometry for identity confirmation

    • Dynamic light scattering for aggregation state

Stability Optimization:

Based on commercial product recommendations:

  • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • For long-term storage, add 50% glycerol and store at -20°C/-80°C

  • Working aliquots can be maintained at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

Functional Validation:

Before structural studies or drug screening:

  • Verify enzymatic activity in vitro

  • Test thermal stability using differential scanning fluorimetry

  • Assess proper folding using circular dichroism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.