Recombinant Salmonella paratyphi C UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yqhA; SPC_3223; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
yqhA
Target Protein Sequence
MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links

KEGG: sei:SPC_3223

Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Salmonella paratyphi C UPF0114 protein YqhA?

Salmonella paratyphi C UPF0114 protein YqhA is a membrane protein encoded by the yqhA gene found in Salmonella paratyphi C strain RKS4594. The protein belongs to the UPF0114 family (Uncharacterized Protein Family 0114), indicating its function has not been fully characterized. This protein is found in various Salmonella strains, including S. paratyphi strains that cause paratyphoid fever, a potentially fatal systemic infection in humans. The gene is located at locus SPC_3223 in the Salmonella paratyphi C genome, and the protein consists of 164 amino acids in its full-length form . Genomic analysis has demonstrated that this protein is conserved across different Salmonella serotypes, suggesting it may serve an important physiological function in these bacteria .

What is the cellular location and proposed function of YqhA protein?

Based on sequence analysis, YqhA is a membrane protein with several hydrophobic regions characteristic of transmembrane domains. The amino acid sequence reveals features typical of integral membrane proteins, including hydrophobic stretches that likely span the bacterial membrane . While the specific function of YqhA remains uncharacterized (hence the UPF0114 designation), its conservation across Salmonella strains suggests it plays an important role in bacterial physiology.

The protein's membrane location suggests it may be involved in:

  • Membrane integrity or organization

  • Transport processes across the membrane

  • Signal transduction

  • Potential interactions with host cells during infection

How is recombinant YqhA protein used in vaccine development research?

Recombinant YqhA protein has potential applications in vaccine development against Salmonella infections. While specific research on YqhA-based vaccines is limited in the literature, several approaches are being investigated:

  • As a potential antigen: Being a membrane protein, YqhA could serve as a target for immune recognition. Recombinant YqhA is being used in research efforts focused on vaccine development, as indicated by commercial offerings specifically targeting this application .

  • As part of multi-antigen strategies: Research in Salmonella vaccines has identified several outer membrane proteins with immunogenic potential. Studies have shown that proteins like LamB, PagC, TolC, NmpC, and FadL from Salmonella paratyphi A confer significant protection rates in animal models. Similar approaches could be applied to YqhA from S. paratyphi C .

  • For cross-protection studies: Given that YqhA appears highly conserved across different Salmonella strains, research is exploring whether immune responses against this protein might provide cross-protection against multiple Salmonella serovars .

Bivalent vaccine approaches incorporating elements from both S. typhi and S. paratyphi are being developed, as demonstrated by work with the viaB locus and the creation of attenuated strains carrying deletions in virulence genes like htrA and phoPQ . While these specific studies don't mention YqhA directly, they establish a framework where conserved proteins like YqhA could be valuable in developing broadly protective vaccines.

Based on manufacturer recommendations and research protocols, the following storage and handling guidelines should be observed for recombinant YqhA protein:

Long-term storage:

  • Store at -20°C for routine storage

  • For extended stability, store at -80°C

  • Shelf life: approximately 6 months for liquid formulations and 12 months for lyophilized forms when stored at -20°C/-80°C

Working conditions:

  • Store working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • For liquid formulations, the protein is typically supplied in a Tris-based buffer with 50% glycerol for stability

Reconstitution (for lyophilized protein):

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) is recommended for aliquoting and long-term storage

Following these guidelines will help maintain protein structure and activity for experimental applications.

What are effective protocols for purifying recombinant YqhA protein?

While specific purification protocols for YqhA are not extensively detailed in the literature, effective strategies can be derived from standard membrane protein purification approaches and the limited information available:

General purification workflow:

  • Expression optimization:

    • Select appropriate expression system (baculovirus systems have shown success with >85% purity)

    • Optimize induction conditions to maximize protein expression

  • Cell lysis and membrane fraction isolation:

    • Use gentle lysis methods (sonication or French press)

    • Separate membrane fractions through differential centrifugation

    • Employ detergent solubilization (common detergents include DDM, LDAO, or OG)

  • Affinity purification:

    • If expressed with affinity tags (the specific tag type is determined during the production process)

    • Common tags include His-tag, GST, or MBP

    • Purify using appropriate affinity resins

  • Further purification:

    • Size exclusion chromatography to remove aggregates and achieve higher purity

    • Ion exchange chromatography as an additional purification step

    • Target purity should be >85% as assessed by SDS-PAGE

  • Quality control:

    • Verify purity by SDS-PAGE

    • Confirm identity by Western blot or mass spectrometry

    • Assess protein folding by circular dichroism if structural studies are planned

For membrane proteins like YqhA, maintaining proper folding during purification is critical, which may necessitate the continuous presence of appropriate detergents throughout the purification process.

How can researchers measure the biological activity of YqhA protein?

  • Functional complementation studies:

    • Generate yqhA gene knockout mutants in Salmonella

    • Assess phenotypic changes in growth, stress response, or virulence

    • Complement with recombinant YqhA to verify function restoration

  • Membrane integrity assays:

    • Evaluate membrane permeability in the presence/absence of functional YqhA

    • Measure susceptibility to membrane-disrupting agents

  • Protein-protein interaction studies:

    • Perform pull-down assays to identify binding partners

    • Use bacterial two-hybrid systems to screen for interacting proteins

    • Apply crosslinking approaches to capture transient interactions

  • Localization studies:

    • Use fluorescently tagged YqhA to determine subcellular localization

    • Assess changes in localization under different growth conditions or during infection

  • Structural studies:

    • Employ techniques such as X-ray crystallography or cryo-electron microscopy

    • Infer potential function from structural homology to characterized proteins

Given that S. paratyphi C has undergone significant genomic changes during human adaptation , comparing YqhA function between different Salmonella serovars may provide insights into its potential role in host specificity or virulence.

What immunological assays are suitable for detecting YqhA antibodies?

Several immunological assays are appropriate for detecting antibodies against YqhA protein:

  • Enzyme-Linked Immunosorbent Assay (ELISA):

    • Most commonly used method for YqhA antibody detection

    • Recombinant YqhA can be used as the coating antigen

    • Suitable for both qualitative and quantitative antibody measurements

    • Can be adapted for various sample types (serum, culture supernatants)

  • Western Blotting:

    • Useful for confirming antibody specificity

    • Allows detection of potential cross-reactivity with related proteins

    • Provides information on antibody recognition of denatured vs. native epitopes

  • Immunoprecipitation:

    • For studying protein-antibody interactions in solution

    • Can help identify conformational epitopes

    • Useful for isolating protein complexes containing YqhA

  • Flow Cytometry:

    • For detecting surface-exposed epitopes in native bacterial cells

    • Can be used to quantify antibody binding to bacterial populations

  • Bead-Based Multiplex Assays:

    • Allow simultaneous detection of antibodies against multiple Salmonella antigens

    • Useful for evaluating immune responses to multivalent vaccine candidates

For vaccine development research, combining multiple assays provides comprehensive characterization of immune responses. Studies on outer membrane proteins of Salmonella have shown that antisera against recombinant proteins can confer significant immunoprotection in mice, suggesting similar approaches could be valuable for YqhA research .

How does YqhA potentially contribute to Salmonella paratyphi C pathogenesis?

While direct evidence linking YqhA to Salmonella pathogenesis is limited in the literature, several hypotheses can be formulated based on genomic and evolutionary studies:

  • Host adaptation mechanism:
    Genomic analysis has revealed that S. paratyphi C has diverged from a common ancestor with S. choleraesuis specifically through adaptation to humans. This adaptation process involved "favorable changes of nucleotides/amino acids" that were "quickly selected and accumulated to facilitate the host shift" . As a membrane protein, YqhA could be involved in this adaptation process by mediating interactions with the human host environment.

  • Membrane integrity during infection:
    Membrane proteins are crucial for bacterial survival in stressful host environments. YqhA might play a role in maintaining membrane integrity under the stress conditions encountered during infection, such as exposure to antimicrobial peptides, pH changes, or oxidative stress.

  • Evolutionary conservation implications:
    The conservation of YqhA sequence across different Salmonella strains suggests functional importance. Interestingly, S. paratyphi C shares more genes (4346) with S. choleraesuis than with S. typhi (4008) , indicating that YqhA might belong to a core set of proteins essential for the specific pathogenic mechanisms of these closely related serovars.

  • Potential relationship to virulence factors:
    Studies have identified several Salmonella pathogenicity islands (SPIs) and virulence factors important for Salmonella pathogenesis . While YqhA is not explicitly mentioned among these factors, its membrane location could place it in proximity to known virulence mechanisms such as secretion systems or adhesins.

Understanding YqhA's role in pathogenesis would require targeted studies using knockout mutants and virulence assays in appropriate infection models, which represents an important direction for future research.

What structural similarities and differences exist between YqhA proteins across Salmonella species?

Analysis of YqhA proteins across different Salmonella serovars reveals striking conservation at the sequence level:

This conservation pattern makes YqhA an interesting candidate for research into fundamental Salmonella biology that transcends serovar-specific adaptations, potentially identifying it as part of the core functional machinery common to these pathogens.

How has evolutionary pressure affected the YqhA gene in human-adapted Salmonella strains?

Genomic analysis of Salmonella serovars provides insights into how evolutionary pressure might have affected the YqhA gene during host adaptation:

  • Conservation despite genomic flux:
    While Salmonella paratyphi C has undergone significant genomic changes during adaptation to humans, including differential nucleotide substitutions and pseudogene formation , the YqhA protein sequence appears highly conserved. This suggests the protein might play an essential role that cannot tolerate substantial changes.

  • Selection pressure analysis:
    Studies of S. paratyphi C evolution have noted that adaptation to humans involved greater nonsynonymous (dN) than synonymous (dS) substitutions between S. paratyphi C and S. choleraesuis . A detailed dN/dS ratio analysis of the yqhA gene could reveal whether it has been under purifying selection (conserving function) or positive selection (adapting function).

  • Convergent vs. divergent evolution:
    Research has shown that human-adapted typhoid agents (including S. paratyphi C) do not share a common ancestor but rather represent convergent evolution . The high conservation of YqhA across different serovars might indicate it belongs to the core genome rather than to the parts involved in host-specific adaptation.

  • Pseudogene context:
    S. paratyphi C contains 152 pseudogenes, with 149 in the chromosome . The fact that yqhA is not among these pseudogenes supports its continued functional importance in human-adapted strains, unlike many genes that became non-functional during host adaptation.

The retention of a highly conserved YqhA protein across different host-adapted Salmonella strains suggests it performs a fundamental function that remains important regardless of host specialization, making it distinct from the genes that undergo significant changes during host adaptation processes.

What are the current limitations in YqhA research?

Research on YqhA protein faces several significant limitations:

  • Functional characterization gap:
    The classification of YqhA as a UPF0114 protein indicates its function remains uncharacterized. This fundamental knowledge gap hampers directed research into its biological role and potential applications .

  • Limited structural data:
    No high-resolution structural information for YqhA appears in the current literature. As a membrane protein, it presents technical challenges for structural determination using traditional methods like X-ray crystallography.

  • Pathogenesis relationship unclear:
    Despite genomic evidence showing YqhA conservation across pathogenic Salmonella strains, its specific contribution to virulence or host adaptation remains undefined .

  • Technical challenges in protein handling:
    As a membrane protein, YqhA poses challenges for expression, purification, and functional assays while maintaining native conformation. This complicates experimental approaches and may contribute to the limited research.

  • Gene regulation unknown:
    Information about how yqhA gene expression is regulated under different conditions or during infection is absent from the available literature, leaving an important aspect of its biology unexplored.

Addressing these limitations would require dedicated studies using techniques optimized for membrane proteins, coupled with functional genomics approaches and robust infection models.

How might YqhA be utilized in next-generation vaccine strategies?

YqhA protein presents several potential applications in advanced vaccine development strategies:

  • Component of subunit vaccines:
    As a highly conserved membrane protein, YqhA could serve as an antigen in subunit vaccines targeting multiple Salmonella serovars. This approach has shown promise with other outer membrane proteins from Salmonella, where recombinant proteins demonstrated protection rates up to 95% in animal models .

  • Carrier protein for polysaccharide antigens:
    YqhA could potentially serve as a carrier protein in conjugate vaccines, similar to approaches using diphtheria toxoid conjugated to Salmonella O-specific polysaccharide . Its membrane origin might enhance presentation of attached polysaccharide antigens.

  • Part of multivalent vaccine formulations:
    Combining YqhA with other Salmonella antigens could provide broader protection against multiple serovars. Research has demonstrated that combining cellular components and attenuated strains can elicit stronger immune responses than single antigens .

  • Target in attenuated live vaccines:
    Rather than using the protein itself, the yqhA gene could be modified in attenuated live vaccine strains to enhance immunogenicity or attenuation, similar to approaches targeting genes like htrA, guaBA, and clpX .

  • Platform for epitope display:
    If surface-exposed regions of YqhA are identified, these could serve as platforms for displaying epitopes from other pathogens or from multiple Salmonella antigens.

The high conservation of YqhA across Salmonella strains makes it particularly interesting for developing cross-protective vaccines that could address the increasing incidence of paratyphoid fever caused by multiple serovars .

What novel techniques could enhance YqhA protein characterization?

Several cutting-edge approaches could advance our understanding of YqhA protein:

  • Cryo-electron microscopy:
    This technique has revolutionized membrane protein structural biology and could resolve YqhA's structure without crystallization, providing insights into function through structural analysis. Recent advances allow near-atomic resolution of membrane proteins in their native lipid environment.

  • Native mass spectrometry:
    This approach can analyze membrane proteins within their native lipid environment, potentially revealing interaction partners and structural conformations of YqhA that would be lost in traditional denaturing approaches.

  • Single-cell tracking during infection:
    Using fluorescently tagged YqhA and advanced microscopy, researchers could track protein localization and dynamics during actual infection processes, correlating its behavior with key stages of pathogenesis.

  • CRISPR-Cas9 mutagenesis:
    Precise genome editing could create subtle mutations in yqhA to identify key functional residues without completely abolishing protein expression, helping to map structure-function relationships.

  • AlphaFold2 and related AI approaches:
    These powerful machine learning tools could predict YqhA's structure with high confidence, potentially revealing functional domains and generating testable hypotheses about its role.

  • Transcriptomics and proteomics integration:
    Multi-omics approaches comparing yqhA knockout strains with wild-type under various conditions could reveal pathways affected by YqhA, providing functional insights even without prior knowledge of its specific biochemical activity.

  • Nanodiscs and liposome reconstitution:
    These systems allow membrane proteins to be studied in controlled lipid environments, potentially enabling functional assays that would be impossible in detergent solutions.

Implementing these advanced methods could overcome many current limitations in YqhA research and accelerate understanding of this conserved but enigmatic Salmonella protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.