Recombinant Salmonella paratyphi C UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella Paratyphi C UPF0208 Membrane Protein YfbV (yfbV)

Recombinant Salmonella paratyphi C UPF0208 membrane protein YfbV (yfbV) is a protein expressed in Salmonella paratyphi C, specifically the RKS4594 strain, and also found in other organisms like E. coli . YfbV is also identified as SPC_1372 and belongs to the UPF0208 protein family. It is a membrane protein located in the cell's inner membrane, characterized as a multi-pass transmembrane protein.

Key characteristics:

  • Source: Salmonella paratyphi C (strain RKS4594)

  • Synonyms: yfbV; SPC_1372; UPF0208 membrane protein YfbV

  • Location: Cell inner membrane

  • Nature: Multi-pass membrane protein

  • Function: The precise biological function of YfbV is not well-defined, but it is classified within the UPF0208 family of proteins. Proteins of unknown function (UPF) are conserved proteins with no known function.

  • Expression: Can be expressed in various systems, including E. coli, yeast, baculovirus, and mammalian cells.

Production and Properties

Recombinant YfbV is produced using recombinant DNA technology, often expressed in E. coli as a host organism . The recombinant protein is often synthesized as a partial protein. The recombinant form of this protein is available with an N-terminal His tag to allow for purification and detection .

Table 1: Properties of Recombinant YfbV Protein

PropertyDescription
TagHis-Tag (tag type determined during production)
PurityGreater than 85% (SDS-PAGE)
FormLyophilized powder
Buffer before LyophilizationTris/PBS-based buffer, 6% Trehalose
ApplicationsResearch and development, immunoassay development, ELISA, Western blot

Potential Applications

While specific applications for Salmonella paratyphi C UPF0208 membrane protein YfbV (yfbV) are not detailed in the references, the broader context of Salmonella outer membrane proteins (OMPs) suggests potential uses in vaccine development and diagnostics . OMPs play a role in bacterial adaptation, adherence, and host cell colonization . Furthermore, some Salmonella OMPs have been demonstrated to elicit long-lasting and protective immunity .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yfbV; SPC_1372; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPVAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: sei:SPC_1372

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0208 membrane protein YfbV and what organisms express it?

UPF0208 membrane protein YfbV is a bacterial membrane protein found in various Salmonella enterica serovars, including Salmonella paratyphi C, Salmonella typhimurium, and Salmonella enterica subsp. enterica serovar Paratyphi B . The protein belongs to the UPF0208 family (Uncharacterized Protein Family 0208), indicating that while its structure can be predicted, its precise biological function remains incompletely characterized. YfbV is encoded by the yfbV gene, which has also been identified in various Salmonella strains with high sequence conservation .

What structural information is available for YfbV?

Structural information for YfbV includes computational models generated through AlphaFold. The AlphaFold model for YfbV from Salmonella enterica subsp. enterica serovar Paratyphi B (UniProtKB: A9N4B4) was released on December 9, 2021, and last modified on September 30, 2022 . This model has a global pLDDT (predicted Local Distance Difference Test) score of 82.42, placing it in the "Confident" prediction category (70 < pLDDT ≤ 90) . While this computational model provides valuable insights into potential structural features, it's important to note that there are currently no experimental crystallographic or cryo-EM structures available to verify the accuracy of this model.

What expression systems are recommended for recombinant production of YfbV?

E. coli is the predominantly used expression system for recombinant production of Salmonella paratyphi C YfbV protein . When expressing the full-length protein (1-151 amino acids), incorporating an N-terminal His-tag has proven effective for downstream purification processes . Alternative expression systems that might be suitable include yeast, baculovirus, or mammalian cell systems, although E. coli remains the most well-documented host for this specific protein .

The standard approach involves cloning the full yfbV gene sequence into an appropriate expression vector with an N-terminal His-tag, transforming into competent E. coli cells, inducing expression, and then purifying using affinity chromatography.

What storage conditions maximize stability of recombinant YfbV?

Based on empirical evidence, the following storage recommendations maximize the stability and activity of recombinant YfbV protein:

Storage PurposeRecommended ConditionsNotes
Long-term storage-20°C to -80°CAliquoting is necessary to avoid freeze-thaw cycles
Working stocks4°CStable for up to one week
Storage bufferTris/PBS-based buffer, pH 8.0 with 6-50% trehalose or glycerolBuffer composition may vary based on downstream applications

It is strongly recommended to avoid repeated freeze-thaw cycles as they significantly reduce protein stability and activity . For optimal results, the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added as a cryoprotectant before aliquoting for long-term storage .

What reconstitution protocols are optimal for lyophilized YfbV preparations?

The optimal reconstitution protocol for lyophilized YfbV involves briefly centrifuging the vial prior to opening to ensure all contents are at the bottom . The lyophilized protein should then be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage stability, adding glycerol to a final concentration of 5-50% is recommended, with 50% being the standard practice for most applications .

This protocol maintains protein stability while minimizing the risk of denaturation during the reconstitution process. After reconstitution, the solution should be gently mixed rather than vortexed to prevent protein aggregation.

How reliable are computational models of YfbV structure?

Researchers should note several important considerations:

While the AlphaFold model provides valuable structural insights, experimental validation through techniques such as circular dichroism, limited proteolysis, or ideally X-ray crystallography would be necessary to confirm structural features with certainty.

What topology predictions exist for YfbV as a membrane protein?

As a UPF0208 family membrane protein, YfbV is predicted to have membrane-spanning regions, though the exact topology has not been experimentally verified in available literature . The amino acid sequence contains hydrophobic stretches consistent with transmembrane domains, particularly in regions containing sequences rich in leucine, isoleucine, and other hydrophobic residues .

Based on the sequence analysis and computational modeling, researchers can investigate the membrane topology using experimental approaches such as:

  • Protease accessibility assays with isolated membrane fractions

  • Site-directed fluorescence labeling at predicted loop regions

  • Epitope insertion studies at predicted extracellular/cytoplasmic domains

  • Glycosylation mapping of potential extracellular domains

These experimental approaches would provide validation of the computationally predicted membrane topology and orientation.

How does the evolutionary conservation of YfbV inform functional studies?

The high sequence conservation of YfbV across different Salmonella serovars suggests functional importance . The identical amino acid sequence observed between S. paratyphi C and S. typhimurium YfbV proteins indicates strong evolutionary pressure to maintain this specific sequence . This conservation can guide research in several ways:

  • Identification of critical functional residues through comparative analysis with more distant homologs

  • Targeted mutagenesis of conserved motifs to elucidate structure-function relationships

  • Cross-species complementation studies to determine functional equivalence

  • Analysis of selection pressure on different protein domains to identify regions under functional constraints

Research approaches that leverage this evolutionary conservation may include constructing chimeric proteins with domains from different species, or performing deep mutational scanning to identify residues critical for function.

What techniques are most appropriate for studying YfbV-protein interactions?

Given the membrane localization of YfbV, specialized techniques for studying membrane protein interactions are most appropriate:

  • Crosslinking studies: Using membrane-permeable crosslinkers followed by immunoprecipitation and mass spectrometry to identify interaction partners

  • Bacterial two-hybrid systems: Modified for membrane proteins to detect potential protein-protein interactions

  • Co-immunoprecipitation with membrane-solubilizing detergents: Optimizing detergent conditions to maintain native interactions while solubilizing the membrane

  • Proximity labeling approaches: Such as BioID or APEX2, where YfbV is fused to an enzyme that biotinylates proximal proteins

Each approach has strengths and limitations, and researchers should consider factors such as the transient nature of potential interactions, detergent effects on protein structure, and the cellular localization of YfbV when designing interaction studies.

How can YfbV be differentiated from other membrane proteins during isolation?

Differentiating YfbV from other membrane proteins during isolation requires a multi-faceted approach:

  • Affinity tag purification: Using the N-terminal His-tag for initial purification via immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography: Further purifying based on the 151-amino acid length of YfbV

  • Immunological detection: Using antibodies specific to YfbV or its affinity tag

  • Mass spectrometry verification: Confirming protein identity through peptide mass fingerprinting

  • SDS-PAGE analysis: Verifying protein purity (>90% as typically achieved)

For highest purity isolation, a two-step purification protocol combining IMAC followed by size exclusion chromatography is recommended, with verification by Western blot using anti-His antibodies or YfbV-specific antibodies.

How does YfbV relate to bacterial pathogenesis mechanisms?

While direct evidence linking YfbV to pathogenesis mechanisms is limited in the provided search results, important context can be gained from related research on Salmonella pathogenesis. In Salmonella enterica serovar Typhi, type IVB pili facilitate bacterial self-association, which may be important in typhoid fever pathogenesis . The pil operon in S. paratyphi C is very similar to that of serovar Typhi, though with an inactive shufflon that influences pilus function and bacterial self-association .

As a membrane protein, YfbV may potentially play roles in:

  • Membrane integrity and cellular homeostasis

  • Sensing environmental conditions in the host

  • Potential involvement in bacterial adhesion or invasion mechanisms

  • Possible contributions to antimicrobial resistance through membrane permeability

Further research using gene knockout studies, complementation assays, and virulence assessment in cellular and animal models would be necessary to establish direct links between YfbV and pathogenesis.

What comparative approaches could reveal functional differences in YfbV across Salmonella serovars?

Despite high sequence conservation, subtle functional differences in YfbV across Salmonella serovars might exist. Researchers can employ these comparative approaches:

  • Complementation studies: Expressing YfbV from different serovars in a YfbV knockout strain to assess functional equivalence

  • Chimeric protein analysis: Creating fusion proteins with domains from different serovar YfbVs to map functional regions

  • Host-specific interaction studies: Investigating if YfbV from different serovars interacts differently with host factors

  • Heterologous expression phenotypes: Examining if expression of YfbV from different serovars in E. coli produces different phenotypes

Such comparative approaches could reveal subtle functional adaptations that contribute to the distinct pathogenicity profiles of different Salmonella serovars, even among highly conserved proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.