Recombinant Salmonella paratyphi C UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella paratyphi C UPF0259 Membrane Protein yciC

The UPF0259 membrane protein yciC, derived from Salmonella paratyphi C strain RKS4594, belongs to a family of uncharacterized proteins with membrane-associated functions. The designation "UPF0259" indicates that it is part of an uncharacterized protein family, suggesting that while its structural characteristics are known, its precise biological functions remain partially elucidated. As a membrane protein, yciC likely plays roles in cellular processes involving membrane integrity, transport, or signaling pathways within this pathogenic bacterium .

Salmonella paratyphi C is one of several pathogens responsible for enteric fever, a potentially fatal systemic infection in humans. While Salmonella typhi has been traditionally considered the primary causative agent of typhoid fever, the significance of Salmonella paratyphi C in human infections has been increasingly recognized. The recombinant form of yciC protein is produced through expression systems that allow for high-yield purification of the protein for research and potential therapeutic applications .

Molecular Properties

The yciC protein exhibits several key molecular properties that are consistent with its membrane localization:

PropertyCharacteristicNotes
Protein FamilyUPF0259Uncharacterized protein family
UniProt AccessionC0Q399Reference identifier for Salmonella paratyphi C yciC
Locus NameSPC_1995Genomic identifier in S. paratyphi C RKS4594
Expression RegionAmino acids 1-247Full-length protein
Predicted LocalizationBacterial membraneBased on sequence hydrophobicity analysis
Source OrganismSalmonella paratyphi C (strain RKS4594)Clinical isolate

The physical characteristics of the recombinant yciC protein include hydrophobic regions that facilitate its integration into membranes, consistent with its classification as a membrane protein .

The yciC Gene in Salmonella paratyphi C

The gene encoding the yciC protein (designated as SPC_1995) is located within the chromosome of Salmonella paratyphi C strain RKS4594, which has a total size of approximately 4,833,080 base pairs. This strain also contains a plasmid of 55,414 base pairs, although the yciC gene is chromosomally encoded. The genomic context of yciC provides insights into its potential regulatory networks and functional associations within the Salmonella paratyphi C genome .

Evolutionary Comparison with Other Salmonella Strains

Comparative genomic analysis reveals that yciC homologs are present across various Salmonella species, including Salmonella paratyphi A, which contains a highly similar protein (UniProt: Q5PD19). Sequence alignment between the yciC proteins from S. paratyphi C and S. paratyphi A demonstrates high conservation, with only minor variations in the amino acid sequence :

SpeciesUniProt IDAmino Acid Differences
S. paratyphi CC0Q399Reference sequence
S. paratyphi AQ5PD19Variation at position 172 (I→V)

This high level of conservation suggests functional importance of the yciC protein across different Salmonella serovars, potentially relating to common membrane-associated functions across these pathogens .

Genomic analyses have revealed that Salmonella paratyphi C shares significantly more genes with Salmonella choleraesuis (approximately 4,346 genes) than with Salmonella typhi (approximately 4,008 genes), suggesting a closer evolutionary relationship between S. paratyphi C and S. choleraesuis. This relationship is further supported by phylogenetic analyses based on shared genes across multiple Salmonella strains .

Recombinant Expression Systems

The recombinant Salmonella paratyphi C UPF0259 membrane protein yciC is typically produced using one of several expression systems:

Expression SystemAdvantagesNotes
YeastPost-translational modifications, high yieldCommonly used for commercial production
E. coliRapid growth, high protein expressionMay require optimization for membrane proteins
BaculovirusSuperior for complex proteinsHigher production costs
Mammalian cellsNative-like folding and modificationsSlower growth, higher maintenance

Commercial recombinant yciC protein preparations often utilize yeast expression systems to ensure proper protein folding and post-translational modifications. The resulting protein product typically achieves a purity greater than 85% as determined by SDS-PAGE analysis .

Potential Role in Pathogenicity

While the specific function of yciC in Salmonella pathogenicity remains under investigation, several lines of evidence suggest its potential importance:

  1. Conservation across pathogenic Salmonella strains indicates a possibly essential function

  2. Membrane localization suggests roles in host-pathogen interactions or environmental sensing

  3. Presence in clinical isolates of Salmonella paratyphi C points to potential association with virulence

The study of yciC may contribute to understanding the molecular mechanisms underlying the host adaptation and pathogenicity of Salmonella paratyphi C, which has evolved specific mechanisms for human infection .

Research and Diagnostic Applications

Recombinant yciC protein has several applications in research and diagnostics:

  1. Immunological Studies: As an immunogen, the protein can be used to generate antibodies for detection and research purposes

  2. Vaccine Development: Understanding membrane proteins like yciC may contribute to novel vaccine strategies

  3. Pathogenesis Research: Studying the function of yciC may reveal mechanisms of Salmonella adaptation to human hosts

  4. Diagnostic Tools: Antibodies against yciC could potentially be used in diagnostic assays for Salmonella paratyphi C infections

Recent research has shown interest in engineering Salmonella strains for vaccine development, such as the incorporation of Vi capsular polysaccharide genes into S. paratyphi A to create bivalent vaccines against both S. typhi and S. paratyphi A infections. Similar approaches could potentially involve membrane proteins like yciC for developing vaccines with broader protection against multiple Salmonella serovars .

yciC in Salmonella and Related Pathogens

The UPF0259 membrane protein family, including yciC, extends beyond Salmonella to other enterobacteriaceae. Comparative analysis reveals presence of yciC homologs in several pathogenic bacteria:

OrganismProtein IdentityGene DesignationNotable Characteristics
Salmonella paratyphi CUPF0259 membrane protein yciCSPC_1995Full 247 amino acid protein
Salmonella paratyphi AUPF0259 membrane protein yciCSPA1143Single I→V substitution at position 172
Escherichia coliUPF0259 membrane protein yciCStrain-dependentPresent in pathogenic strains including EAEC

Notably, the yciC gene has been identified in particular strains of uropathogenic Escherichia coli (UPEC), suggesting a possible role in urinary tract infections. The protein has been found specifically in strains designated as NGE3, NGE7, and NGE16, but was absent in several other UPEC isolates, indicating potential strain-specific functions or horizontal gene transfer events .

Functional Implications from Comparative Studies

The selective presence of yciC across different bacterial strains and species suggests that this protein may contribute to specific adaptive advantages. In uropathogenic E. coli, the presence of yciC correlates with certain strain-specific pathogenic properties, potentially indicating a role in pathogenicity island-mediated functions. The protein may be involved in membrane-related processes that enhance bacterial survival or virulence in specific host environments .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please communicate it to us, and we will prioritize its development.
Synonyms
yciC; SPC_1995; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
yciC
Target Protein Sequence
MSITAKSVYRDAGNFFRNQFITILLVSLLCAFITVVLGHAFSPSDAQIAQLSEGEHLAGS AGLFELVQNMTPEQQQILLRASAASTFSGLIGNAILAGGIILMIQLVSAGHRVSALRAIG ASAPALPKLFILIFLTTLLVQIGIMLIIVPGIIMAIVLALAPVMLVEEKMGVFAAMRSSM RLAWANMRLVAPAVIGWLLAKTLLLLFAPSFAVLTPNVGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links

KEGG: sei:SPC_1995

Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Salmonella paratyphi C UPF0259 membrane protein yciC?

The UPF0259 membrane protein yciC in Salmonella paratyphi C belongs to a family of outer membrane proteins that contribute to bacterial cell envelope integrity and interaction with the environment. While specific structural information for S. paratyphi C yciC is limited, comparative analyses with homologous proteins suggest it likely functions in membrane stability and transport mechanisms. Similar to other outer membrane proteins (OMPs) found in Salmonella enterica, yciC likely contributes to bacterial adaptation to environmental conditions, motility, adherence, and host cell colonization. These proteins also typically function in transmembrane transport of nutrients and ions and may play roles in the secretion of toxins and cellular proteases .

To characterize the structure, researchers typically employ techniques including circular dichroism, X-ray crystallography, and nuclear magnetic resonance spectroscopy, often comparing results with better-characterized homologous proteins from related bacterial species. Functional characterization should combine in silico prediction tools with experimental approaches such as site-directed mutagenesis and phenotypic assessments.

How does the expression of yciC differ between Salmonella paratyphi C and other Salmonella serovars?

Expression patterns of yciC appear to vary across Salmonella serovars, which may contribute to differences in pathogenicity and host specificity. Based on comparative genomic analyses, expression levels of membrane proteins like yciC can be influenced by environmental factors, growth conditions, and host interactions that differ between Salmonella enterica serovars.

To investigate these differences, researchers should employ quantitative RT-PCR to measure expression levels under standardized conditions, comparing S. paratyphi C with other serovars such as S. Typhi and S. Paratyphi A. RNA-seq analysis provides a more comprehensive view of differential expression patterns. Protein-level expression can be assessed through western blotting and mass spectrometry approaches, ideally using antibodies specific to conserved regions of the yciC protein. Differences in expression patterns may correlate with the distinct pathogenic profiles of these serovars, including their varying abilities to cause enteric fever versus gastroenteritis.

What expression systems are most effective for producing recombinant Salmonella paratyphi C yciC protein?

For effective recombinant expression of Salmonella paratyphi C yciC, several expression systems can be considered, each with distinct advantages. E. coli-based systems are commonly used for initial protein production attempts due to their simplicity and high yield potential . The pET expression system with BL21(DE3) or its derivatives has proven successful for many bacterial membrane proteins, using an N-terminal or C-terminal His-tag for purification purposes, similar to the approach used for other Salmonella membrane proteins .

For more challenging membrane proteins, alternative expression hosts including yeast (Pichia pastoris), baculovirus-infected insect cells, or mammalian cells may provide better results, particularly if post-translational modifications are important . To optimize expression, researchers should consider:

  • Codon optimization for the chosen expression host

  • Induction conditions (temperature, inducer concentration, induction time)

  • Addition of membrane-stabilizing agents during expression

  • Use of fusion partners (MBP, SUMO, etc.) to enhance solubility

  • Testing different detergents for membrane protein extraction

Expression trials should systematically compare protein yields and functional integrity across different systems before scaling up production.

What role does yciC play in Salmonella paratyphi C pathogenesis and immune evasion?

While direct evidence for yciC's role in S. paratyphi C pathogenesis is limited in the provided search results, research on related membrane proteins suggests potential involvement in several virulence mechanisms. As a membrane protein, yciC likely contributes to bacterial surface properties that influence host-pathogen interactions.

Studies with other Salmonella membrane proteins have demonstrated roles in bacterial adhesion to host cells, resistance to host defense mechanisms, and modulation of the host immune response . The structural characteristics of outer membrane proteins enable them to participate in bacterial colonization and persistence within host tissues. Membrane proteins can also contribute to bacterial survival by facilitating efflux of antimicrobial compounds and adaptation to environmental stresses within the host .

To investigate yciC's specific role in pathogenesis, researchers should consider:

  • Creating yciC knockout mutants to assess changes in virulence in cellular and animal infection models

  • Evaluating the impact of yciC expression on bacterial survival in conditions mimicking host environments (low pH, antimicrobial peptides, oxidative stress)

  • Examining yciC's potential interaction with host immune components using pull-down assays and immunoprecipitation

  • Assessing whether yciC expression is regulated during different stages of infection using in vivo expression technology

The regulation of yciC expression during infection may provide insights into its functional importance at different stages of the pathogenesis process.

How can yciC be incorporated into vaccine development strategies against Salmonella paratyphi C?

Incorporating yciC into vaccine development strategies against Salmonella paratyphi C represents a promising approach based on the immunogenic potential demonstrated by other Salmonella membrane proteins. Outer membrane proteins have shown considerable promise as vaccine candidates due to their surface exposure, conservation across strains, and ability to elicit protective immune responses .

Several methodological approaches can be considered:

  • Recombinant protein subunit vaccines: Purified recombinant yciC, potentially combined with appropriate adjuvants, could be used to stimulate specific immune responses. This approach has been successful with other Salmonella OMPs that elicit long-lasting and protective immunity .

  • Outer membrane vesicle (OMV)-based vaccines: Incorporating yciC into OMVs or GMMAs (Generalized Modules for Membrane Antigens) represents an innovative delivery system. This approach resembles the bacterial surface where protective antigens are displayed in their native environment, potentially enhancing immunogenicity . GMMAs containing membrane proteins have demonstrated the ability to induce T-cell-dependent, boostable, and highly functional IgG responses .

  • DNA vaccines: Encoding yciC in DNA vaccine constructs could lead to in vivo expression and presentation to the immune system.

  • Multivalent approaches: Combining yciC with other antigenic components, such as O-antigens or Vi capsular polysaccharide, could generate broader protection against multiple Salmonella serovars .

Researchers should systematically evaluate immune responses by measuring antibody titers, assessing antibody functionality through serum bactericidal assays, and determining protection in appropriate animal models before proceeding to clinical trials.

What methods are most effective for studying yciC's interaction with host immune components?

Studying interactions between yciC and host immune components requires a multifaceted approach combining in vitro, ex vivo, and in vivo methodologies. Based on approaches used with other Salmonella membrane proteins, researchers should consider:

  • Protein-protein interaction assays: Yeast two-hybrid systems, pull-down assays, and co-immunoprecipitation can identify potential binding partners from host immune cells. Surface plasmon resonance (SPR) and isothermal titration calorimetry provide quantitative binding parameters.

  • Cell-based assays: Stimulation of immune cells (macrophages, dendritic cells, lymphocytes) with purified yciC can reveal cytokine profiles and activation signatures. Flow cytometry analysis of cell surface markers and intracellular cytokine staining provide insights into cellular responses.

  • Model systems: C. elegans has been used successfully to study immune responses to Salmonella, including the regulation of MAPK and insulin pathways . This model allows for genetic manipulation to investigate specific immune pathways activated by yciC.

  • Transcriptomic approaches: RNA-seq analysis of host cells exposed to yciC can identify regulated genes and pathways, similar to studies showing that S. Paratyphi A can modulate oxidative stress responses and immune signaling .

  • Serum bactericidal assays: These functional tests evaluate whether antibodies against yciC can activate complement-mediated killing of Salmonella, providing evidence for protective immunity .

When designing these studies, researchers should consider both the direct interaction of yciC with pattern recognition receptors and its potential role in modulating downstream immune signaling cascades.

What are the optimal conditions for purifying recombinant yciC protein while maintaining its native conformation?

Purifying membrane proteins like yciC while preserving their native conformation presents significant technical challenges. Based on established protocols for similar proteins, researchers should consider the following optimized approach:

  • Membrane extraction: After bacterial lysis, membrane fractions should be isolated through differential ultracentrifugation. A comparison of different detergents (LDAO, DDM, OG, CHAPS) at varying concentrations is essential to identify conditions that efficiently solubilize yciC without denaturing it.

  • Affinity purification: If the recombinant protein contains a His-tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin represents an effective initial purification step . Optimizing imidazole concentrations in wash and elution buffers minimizes non-specific binding while maximizing target protein recovery.

  • Secondary purification: Size exclusion chromatography separates the target protein from aggregates and differentiates between monomeric and oligomeric states. Ion exchange chromatography may provide additional purification based on the protein's predicted isoelectric point.

  • Buffer optimization: Systematic screening of buffer conditions (pH, salt concentration, presence of stabilizing agents) is crucial for maintaining protein stability. Addition of glycerol (10-15%) often enhances membrane protein stability.

  • Conformation assessment: Circular dichroism spectroscopy should be employed to verify secondary structure integrity, while thermal shift assays evaluate protein stability under various conditions. Native PAGE and analytical ultracentrifugation provide insights into oligomeric state.

The purified protein can be maintained in detergent micelles, reconstituted into liposomes, or stabilized using amphipathic polymers like amphipol A8-35, which has been successfully used with other bacterial OMPs .

What analytical methods are most informative for characterizing the immunogenicity of yciC protein?

Comprehensive characterization of yciC immunogenicity requires multiple analytical approaches to assess both humoral and cellular immune responses. Based on methods used for other Salmonella membrane proteins, researchers should implement:

These methods should be employed in combination to develop a comprehensive understanding of the immune response to yciC and its potential protective efficacy.

How can researchers effectively compare the genetic variability of yciC across different Salmonella paratyphi C isolates?

Effective comparison of yciC genetic variability across different S. paratyphi C isolates requires a systematic genomic approach combining bioinformatic analysis with experimental validation. Researchers should implement the following methodology:

  • Sample collection and sequencing:

    • Assemble a diverse collection of S. paratyphi C isolates representing different geographical regions and timeframes

    • Extract genomic DNA using standardized methods

    • Perform whole-genome sequencing using Illumina or PacBio platforms to ensure high coverage and accuracy

    • Consider targeted sequencing of the yciC gene region for larger sample sets

  • Bioinformatic analysis:

    • Align sequences using programs like MUSCLE, CLUSTAL, or MAFFT

    • Calculate nucleotide diversity (π) and identify single nucleotide polymorphisms

    • Perform selection analysis using dN/dS ratios to identify regions under selective pressure

    • Create phylogenetic trees to visualize relationships between variants

    • Use tools like PROVEAN or SIFT to predict the functional impact of amino acid substitutions

  • Structural analysis:

    • Map variations onto predicted protein structures using homology modeling

    • Identify variations in predicted epitope regions and transmembrane domains

    • Assess conservation of functional domains across isolates

  • Experimental validation:

    • Clone and express representative variant forms of yciC

    • Compare biochemical properties and immunoreactivity of variant proteins

    • Assess functional differences through appropriate assays

  • Data integration:

    • Correlate genetic variations with geographical distribution, clinical outcomes, or antimicrobial resistance profiles

    • Establish a database of variations to monitor evolutionary trends over time

This comprehensive approach provides insights into yciC evolution and helps identify conserved regions suitable for vaccine development or diagnostic applications.

How does yciC compare with other membrane proteins as a potential diagnostic marker for Salmonella paratyphi C infection?

Evaluating yciC as a diagnostic marker for S. paratyphi C infection requires comparative assessment against established and emerging biomarkers. While direct information on yciC's diagnostic utility is limited, insights from research on other Salmonella membrane proteins suggest several considerations:

Membrane proteins have demonstrated value as diagnostic targets due to their surface exposure and immunogenicity . The ideal diagnostic marker should demonstrate high sensitivity (presence in all S. paratyphi C strains) and specificity (absence or significant variation in other pathogens). To evaluate yciC's potential:

  • Sequence analysis: Comprehensive bioinformatic comparison of yciC sequences across Salmonella serovars and other Enterobacteriaceae to identify unique regions specific to S. paratyphi C.

  • Immunoreactivity assessment: Development of monoclonal antibodies targeting yciC-specific epitopes and evaluation of their reactivity profiles across bacterial species and strains.

  • Clinical validation: Testing detection methods against diverse clinical isolates and patient samples from various geographical regions and disease presentations.

  • Comparative performance evaluation: Side-by-side comparison with established diagnostic markers through receiver operating characteristic (ROC) curve analysis to determine sensitivity, specificity, positive predictive value, and negative predictive value.

  • Platform development: Assessment of yciC compatibility with various diagnostic platforms (ELISA, lateral flow, molecular detection) and determination of detection limits.

This systematic evaluation would determine whether yciC offers advantages over existing diagnostic approaches and could guide the development of improved detection methods for S. paratyphi C.

What challenges exist in using C. elegans as a model system for studying yciC's role in pathogenesis?

  • Physiological differences: C. elegans lacks adaptive immunity and certain aspects of innate immunity present in mammalian hosts. The intestinal environment differs significantly from human gastrointestinal conditions, potentially affecting yciC expression and function.

  • Infection route limitations: The natural feeding behavior of C. elegans limits infection routes compared to the complex tissue invasion observed in human salmonellosis.

  • Gene expression differences: Salmonella may express yciC differently in C. elegans compared to mammalian hosts due to environmental sensing and regulatory mechanisms.

  • Technical considerations:

    • Creating consistent bacterial lawns for feeding experiments

    • Maintaining stable bacterial populations in the C. elegans intestine

    • Differentiating between direct effects of yciC and secondary consequences

    • Developing quantitative readouts specific to yciC function

  • Validation requirements: Findings in C. elegans require validation in mammalian models before clinical translation.

Despite these challenges, C. elegans offers advantages for high-throughput screening and genetic manipulation. Researchers should complement C. elegans studies with mammalian cell culture models and mouse infection models to build a comprehensive understanding of yciC's role in pathogenesis across different host environments.

How might yciC be incorporated into multivalent Salmonella vaccines targeting multiple serovars?

Incorporating yciC into multivalent Salmonella vaccines represents an advanced research direction with significant potential for broad protection. Based on approaches used with other Salmonella membrane proteins, several strategies merit consideration:

  • Sequence conservation analysis: Cross-serovar comparison of yciC sequences to identify conserved epitopes that could elicit cross-protective immunity. Focusing on regions with high sequence identity across S. paratyphi C, S. Typhi, and other clinically relevant serovars increases the potential for broad protection.

  • Chimeric protein design: Engineering chimeric constructs that combine conserved regions of yciC with variable regions from multiple serovars. This approach could generate broader epitope coverage while maintaining a single protein construct.

  • GMMA/OMV delivery platforms: Outer membrane vesicle-based vaccines can simultaneously display multiple antigens in their native conformation. Engineering bacteria to express yciC alongside other important antigens like Vi polysaccharide and O-antigens creates multivalent vaccines that target different aspects of bacterial virulence . This approach has shown promise with other Salmonella antigens, inducing strong antibody responses against multiple components simultaneously .

  • Adjuvant co-formulation: Combining yciC with appropriate adjuvants can enhance immunogenicity and potentially broaden the immune response. Different adjuvants may preferentially stimulate distinct aspects of immunity (humoral vs. cellular).

  • Prime-boost strategies: Sequential immunization with different yciC-containing formulations might broaden immune responses and enhance protection against multiple serovars.

Evaluating these approaches requires comprehensive immunogenicity studies and challenge experiments with multiple Salmonella serovars to confirm broad protection. Success would significantly advance efforts to develop vaccines against both typhoid and paratyphoid fevers, addressing an important public health need in endemic regions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.