Recombinant Salmonella paratyphi C UPF0266 membrane protein yobD (yobD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella paratyphi C UPF0266 Membrane Protein yobD (yobD)

The Recombinant Salmonella paratyphi C UPF0266 membrane protein yobD (yobD) is a recombinant protein derived from the bacterium Salmonella paratyphi C. This protein is part of a broader class of proteins known as UPF0266 membrane proteins, which are encoded by the yobD gene. The recombinant form of this protein is produced using in vitro expression systems, typically in Escherichia coli (E. coli), to facilitate its study and application in various biomedical research contexts.

Protein Structure and Function

  • Sequence and Structure: The protein sequence of UPF0266 membrane protein yobD from Salmonella paratyphi C consists of a specific amino acid arrangement that defines its structure and function. The sequence is MTITDLLLILFIAALLAYALYDQFIMPRRNGPTLLSIALLRRGRVDSVIFVGLVAILIYN NVTSHGAQMTTWLLSALALMGFYIFWIRTPRIIFKQRGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLIENQ .

  • Function: While specific functions of the yobD protein are not extensively detailed in the literature, membrane proteins generally play roles in cell signaling, transport, and interaction with the environment.

Production and Purification

  • Production: The recombinant protein is produced in E. coli using in vitro expression systems. This involves transforming E. coli cells with a plasmid encoding the yobD gene, followed by protein expression and purification .

  • Purification: The purification process typically involves affinity purification methods to achieve high purity levels.

Biomedical Applications

  • Vaccine Development: While specific applications of the yobD protein in vaccine development are not detailed, membrane proteins from Salmonella species are being explored for their potential in eliciting immune responses .

  • Diagnostic Tools: Recombinant proteins like yobD can be used in diagnostic assays such as Western blotting (WB) and enzyme-linked immunosorbent assay (ELISA) to detect antibodies against Salmonella paratyphi C .

Research Implications

  • Genomic Analysis: The study of Salmonella paratyphi C proteins, including yobD, contributes to understanding the genomic diversity and population structure of this pathogen. This knowledge can inform public health strategies and epidemiological tracking .

  • Protein-Protein Interactions: Further research on the interactions of yobD with other proteins could reveal insights into its role in bacterial pathogenesis and survival.

Production and Purification Details

ProcessDescription
Expression SystemIn vitro E. coli expression
Purification MethodAffinity purification
PurityNot specified for this particular protein, but generally high

References Hurt, et al. (2023). A rare case of Salmonella Paratyphi C osteomyelitis: A genetic analysis and review. Diagnostic Microbiology and Infectious Disease. Cusabio. (2025). Recombinant Salmonella typhi Universal stress protein A (uspA). Immunobiology. (2019). Salmonella Typhi outer membrane protein STIV is a potential candidate for vaccine development against typhoid and paratyphoid fever. Aviva Systems Biology. (2024). UXAC Recombinant Protein (Salmonella paratyphi C). Gene Biosystems. (2024). Recombinant Salmonella paratyphi C UPF0266 membrane protein yobD (yobD). Gene Biosystems. (2024). Recombinant Salmonella paratyphi C UPF0259 membrane protein yciC. Gene Biosystems. (2024). Recombinant Salmonella paratyphi A UPF0266 membrane protein yobD (yobD). Cusabio. (2025). Recombinant Salmonella paratyphi C UPF0266 membrane protein yobD (yobD).

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yobD; SPC_1896; UPF0266 membrane protein YobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Salmonella paratyphi C (strain RKS4594)
Target Names
yobD
Target Protein Sequence
MTITDLLLILFIAALLAYALYDQFIMPRRNGPTLLSIALLRRGRVDSVIFVGLVAILIYN NVTSHGAQMTTWLLSALALMGFYIFWIRTPRIIFKQRGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLIENQ
Uniprot No.

Target Background

Database Links

KEGG: sei:SPC_1896

Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella paratyphi C and how does it differ from other Salmonella Paratyphi serovars?

Salmonella paratyphi C is one of the serovars of Salmonella enterica that causes paratyphoid fever in humans. Salmonella enterica serovars Paratyphi A, B (tartrate negative), and C are identified as etiologic agents of Salmonella Paratyphi infections . While sharing some characteristics with other Paratyphi serovars, S. paratyphi C has distinct genomic features and epidemiological patterns.

The infection process typically involves ingestion of food or water contaminated with the stool or urine of a carrier. Most cases of paratyphoid fever are acquired during international travel to endemic regions including parts of Asia, Africa, and Latin America . The incubation period typically ranges from 1 to 10 days, and the disease remains communicable as long as paratyphoid bacilli are present in excreta .

Clinical presentations include sustained fever, headache, malaise, anorexia, relative bradycardia, and varying gastrointestinal symptoms, though mild and atypical infections may also occur . Unlike some other Salmonella species, S. paratyphi has humans as its only known reservoir.

What is the current understanding of YobD protein structure and why is it significant for research?

The UPF0266 membrane protein YobD in Salmonella paratyphi C belongs to a family of uncharacterized proteins found in bacterial membranes. As a membrane protein, structural analysis requires specialized techniques such as those outlined in the five-step approach for membrane protein structure determination:

  • Preparation of uniformly 13C/15N labeled protein in proteoliposomes

  • Resolution of individual signals using Magic Angle Spinning (MAS) solid-state NMR

  • Assignment of signals to specific residues

  • Measurement of orientation-dependent frequencies and distance restraints

  • Calculation of the three-dimensional structure

The significance of YobD lies in its potential role in bacterial membrane function, which could impact pathogenesis, survival mechanisms, or antimicrobial resistance. Understanding its structure-function relationship provides insights into basic bacterial physiology and potential therapeutic targets.

What expression systems are most effective for producing functional recombinant YobD protein?

Multiple expression systems should be evaluated when working with membrane proteins like YobD:

When selecting an expression system, consider:

For structural studies specifically, the solid-state NMR approach requires uniformly 13C/15N labeled protein, necessitating expression in minimal media with labeled precursors .

What analytical techniques are essential for confirming the identity and purity of recombinant YobD?

A multi-technique approach is essential for validating recombinant YobD protein:

  • Biochemical identification:

    • SDS-PAGE for size verification and initial purity assessment

    • Western blotting with tag-specific or YobD-specific antibodies

    • Mass spectrometry for precise mass determination and sequence verification

    • N-terminal sequencing to confirm proper processing

  • Structural integrity assessment:

    • Circular dichroism to evaluate secondary structure elements

    • Fluorescence spectroscopy to assess tertiary structure

    • Thermal stability assays to determine protein folding quality

    • Limited proteolysis to identify properly folded domains

  • Homogeneity analysis:

    • Size exclusion chromatography to assess oligomeric state

    • Dynamic light scattering for polydispersity measurement

    • Analytical ultracentrifugation for precise molecular weight determination

    • Native gel electrophoresis for non-denatured size analysis

  • Functional validation:

    • Lipid binding assays to verify membrane interaction capabilities

    • Reconstitution into liposomes to assess membrane insertion

    • Activity assays based on predicted functions (if known)

For membrane proteins specifically, additional considerations include detergent screening to maintain native-like structure and assessing protein-lipid interactions that may be essential for function.

How can researchers optimize membrane protein isolation protocols specifically for YobD?

Optimizing YobD isolation requires systematic evaluation of each purification step:

  • Membrane fraction isolation:

    • Gentle cell lysis methods to preserve membrane integrity (e.g., enzymatic lysis, French press at moderate pressure)

    • Differential centrifugation to separate membrane fractions (e.g., 5,000×g to remove debris, followed by 100,000×g to collect membranes)

    • Multiple washing steps with high salt buffers (300-500 mM NaCl) to remove peripheral proteins

  • Solubilization optimization:

    • Systematic detergent screening using the matrix approach:

Detergent ClassExamplesOptimal ConcentrationBest Applications
Mild Non-ionicDDM, LMNG1-2% for extraction, 0.05-0.1% for purificationStructure studies
ZwitterionicLDAO, FC-120.5-1% for extraction, 0.05% for purificationHigh extraction efficiency
Newer AmphipathicSMA, amphipols2.5% SMA polymerNative lipid environment retention
  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • On-column detergent exchange during washing steps

    • Size exclusion chromatography as final polishing step

    • Monitoring protein quality at each step via activity or structural assays

  • Sample concentration considerations:

    • Careful concentration using centrifugal devices with appropriate molecular weight cutoffs

    • Addition of glycerol (10-15%) to prevent aggregation

    • Adjustment of critical micelle concentration (CMC) of detergents during concentration

The structural analysis approach described in search results emphasizes the importance of reconstituting purified YobD into proteoliposomes for solid-state NMR studies, requiring careful optimization of lipid composition and protein-to-lipid ratios .

What are the current technical challenges in determining the high-resolution structure of YobD using solid-state NMR?

Solid-state NMR structure determination of membrane proteins like YobD faces several technical challenges:

  • Sample preparation complexities:

    • Achieving homogeneous reconstitution in proteoliposomes

    • Optimizing protein-to-lipid ratios for spectral quality

    • Ensuring complete isotopic labeling (13C/15N) for multidimensional experiments

    • Maintaining protein stability during extended data acquisition periods

  • Spectroscopic challenges:

    • Signal overlap in larger membrane proteins

    • Limited sensitivity requiring extended acquisition times

    • Hardware requirements for specialized solid-state NMR experiments

    • Need for both Magic Angle Spinning (MAS) and Oriented Sample (OS) approaches

  • Data analysis and interpretation:

    • Complex assignment strategies for membrane protein spectra

    • Extraction of structural restraints from orientation-dependent frequencies

    • Integration of distance and angular constraints into structure calculations

    • Computational demands of structure refinement

As outlined in the research literature, a comprehensive approach requires:

  • High-field NMR spectrometers (700-750 MHz or higher)

  • Specialized probes for solid-state experiments (e.g., 3.2 mm low-E triple resonance probes)

  • Two- and three-dimensional separated local field (SLF) experiments for angular constraints

  • Integration of multiple NMR parameters into structure calculations

The optimization process typically requires iterative refinement of sample conditions, pulse sequences, and data analysis methods to achieve sufficient resolution for structure determination.

How can metabolomic approaches enhance our understanding of YobD function during infection?

Metabolomic analysis provides valuable insights into YobD function through the detection of altered metabolite profiles:

  • Experimental design considerations:

    • Comparison between wild-type and YobD knockout strains

    • Analysis of host cell responses to infection with each strain

    • Time-course studies to capture dynamic metabolic changes

    • Integration with transcriptomic data for pathway analysis

  • Analytical techniques:

    • Two-dimensional gas chromatography with time-of-flight mass spectrometry (GCxGC/TOFMS) has proven effective for detecting metabolite signals in Salmonella infections

    • The approach can identify hundreds of individual metabolite peaks (695 in one study) with high sensitivity

    • Supervised pattern recognition methods can identify significant metabolite profiles that distinguish between different infection states

  • Data analysis strategies:

    • Orthogonal Projections to Latent Structures Discriminant Analysis (OPLS-DA) for metabolite profile differentiation

    • Receiver-operating characteristic (ROC) curves to assess diagnostic potential of metabolite combinations

    • Identification of key metabolites with highest discriminatory power

Research on Salmonella Typhi and Paratyphi A has demonstrated that a combination of just six metabolites (ethanolamine, gluconic acid, monosaccharide, phenylalanine, pipecolic acid, and saccharide) can provide high discriminatory power between infection states, suggesting similar approaches could reveal YobD's metabolic impact .

What methodological approaches can resolve contradictory findings regarding YobD's role in pathogenesis?

Resolving contradictory findings requires systematic methodological approaches:

  • Standardization of experimental systems:

    • Establish reference strains and constructs

    • Define precise genetic modifications (clean deletions vs. insertional inactivation)

    • Standardize culture conditions and growth phases

    • Use multiple infection models with defined parameters

  • Multi-level phenotypic analysis:

    • Conduct comprehensive virulence testing in multiple models

    • Perform detailed in vitro phenotypic characterization

    • Analyze subcellular localization under identical conditions

    • Examine protein-protein interactions systematically

  • Molecular genetic approaches:

    • Create allelic series with point mutations targeting specific domains

    • Perform complementation with homologs from related species

    • Use controlled expression systems to determine dose-dependency

    • Construct reporter fusions to monitor expression in different conditions

  • Data integration framework:

    • Implement meta-analysis of published and unpublished data

    • Establish a standardized database of YobD experimental results

    • Develop mathematical models to reconcile apparently contradictory observations

    • Adopt Bayesian approaches to weigh evidence from different methodologies

  • Collaborative resolution strategies:

    • Organize multi-laboratory studies with standardized protocols

    • Implement round-robin testing of key findings

    • Establish a consortium approach for comprehensive phenotyping

    • Develop consensus reporting standards for YobD research

This systematic approach can reconcile contradictory findings by identifying condition-dependent effects and methodological variables that influence experimental outcomes.

What techniques can effectively characterize the membrane topology and orientation of YobD?

Multiple complementary techniques should be employed to determine YobD membrane topology:

  • Biochemical mapping approaches:

    • Cysteine scanning mutagenesis with selective labeling of accessible residues

    • Protease protection assays with site-specific proteases

    • Chemical modification accessibility studies

    • Glycosylation mapping with engineered sites

  • Genetic fusion strategies:

    • Reporter fusions (PhoA, LacZ, GFP) at different positions

    • Dual reporter constructs to distinguish cytoplasmic vs. periplasmic locations

    • Systematic truncation analysis with terminal reporters

    • Split protein complementation to identify membrane-spanning segments

  • Spectroscopic methods:

    • Oriented Sample (OS) solid-state NMR to determine angular constraints

    • Site-directed spin labeling with EPR spectroscopy

    • FRET analysis with strategically placed fluorophores

    • Hydrogen-deuterium exchange mass spectrometry

  • Computational integration:

    • Topology prediction algorithms (TMHMM, TOPCONS)

    • Integration of experimental data with computational models

    • Molecular dynamics simulations in membrane environments

    • Evolutionary analysis of conserved topology features

  • Structural validation:

    • The five-step NMR approach described in research provides angular constraints that directly define orientation

    • Two- and three-dimensional separated local field (SLF) spectra resolve orientation-dependent frequencies

    • These frequencies translate directly into angular constraints for structure calculation

The integration of these approaches provides a robust characterization of YobD's membrane topology and orientation, essential for understanding its functional mechanisms.

How can researchers identify potential interaction partners of YobD in host and bacterial membranes?

A systematic multi-method approach is required to identify YobD interaction partners:

  • Proximity-based identification methods:

    • In vivo crosslinking followed by mass spectrometry

    • BioID or APEX2 proximity labeling

    • Split-protein complementation assays

    • Resonance energy transfer approaches (FRET/BRET)

  • Affinity-based approaches:

    • Co-immunoprecipitation with quantitative proteomics

    • Tandem affinity purification with gentle solubilization

    • Pull-down assays with recombinant YobD as bait

    • Yeast two-hybrid using membrane yeast two-hybrid variants

  • Genetic and functional screening:

    • Suppressor screens to identify functional partners

    • Synthetic genetic array analysis for genetic interactions

    • Transcriptional response profiling after YobD perturbation

    • Chemical genetic profiling to identify functional pathways

  • Computational prediction and validation:

    • Machine learning approaches for interaction prediction

    • Co-evolution analysis to identify potential binding interfaces

    • Molecular docking simulations with candidate partners

    • Network analysis of protein-protein interaction databases

  • Validation and characterization:

    • Reconstitution of protein complexes in proteoliposomes

    • Structure determination of complexes using the five-step NMR approach

    • Mutagenesis of predicted interaction interfaces

    • Functional assays to assess biological significance of interactions

The combination of these approaches provides a comprehensive strategy for identifying and validating YobD interaction partners in both bacterial and host cellular contexts.

What are the optimal NMR parameters for studying membrane proteins like YobD in phospholipid bilayers?

Optimizing NMR parameters for YobD structural studies requires attention to several technical aspects:

NMR TechniqueKey ParametersSample RequirementsInformation Obtained
MAS Solid-state NMR10-14 kHz spinning rate, >700 MHz fieldUniformly 13C/15N labeled protein in proteoliposomesIsotropic chemical shifts, distance constraints
OS Solid-state NMRNo spinning, >700 MHz fieldAligned samples on glass platesAngular constraints
2D/3D SLF SpectraLong acquisition times, multiple-pulse sequencesIsotopically labeled samplesResidue-specific assignments
Distance MeasurementsDipolar recoupling sequencesSpecifically labeled samplesTertiary structure constraints

As described in the research literature, optimal experimental conditions include:

  • Instrumentation requirements:

    • High-field NMR spectrometer (700-750 MHz or higher)

    • Specialized probes for solid-state experiments (3.2 mm low-E triple resonance probe)

    • Custom-built probes for oriented sample (OS) solid-state NMR with solenoid coils and strip shields to minimize sample heating

  • Pulse sequence optimization:

    • Separated local field (SLF) experiments for resolving orientation-dependent frequencies

    • Multiple-quantum coherence experiments for improved resolution

    • Dipolar recoupling sequences for distance measurements

    • Temperature compensation in pulse programs

  • Sample optimization:

    • Protein-to-lipid ratios typically 1:50 to 1:100

    • Hydration levels carefully controlled

    • Sample temperature maintained above lipid phase transition

    • Buffer conditions optimized for protein stability

  • Data acquisition strategies:

    • Non-uniform sampling for multidimensional experiments

    • Long experimental times (days to weeks) for complete datasets

    • Multiple complementary experiments for cross-validation

These parameters must be empirically optimized for each specific membrane protein system to achieve the resolution required for structure determination .

What strategies can overcome expression challenges in producing recombinant YobD for structural studies?

Overcoming expression challenges for YobD requires a systematic troubleshooting approach:

  • Genetic construct optimization:

    • Screen multiple construct boundaries to identify stable domains

    • Test various affinity and solubility tags (His6, MBP, SUMO, Trx)

    • Optimize codon usage for expression host

    • Consider synthetic gene design with optimized mRNA folding

    • Remove potential toxic elements (internal promoters, RBS sites)

  • Expression system selection:

    • Test multiple E. coli strains specialized for membrane proteins (C41/C43, Lemo21)

    • Evaluate eukaryotic systems for complex membrane proteins (Pichia, insect cells)

    • Consider cell-free expression systems for direct incorporation into lipid environments

    • Use dual-plasmid systems with chaperones or membrane insertion machinery

  • Culture condition optimization matrix:

ParameterVariables to TestMonitoring Method
Temperature16°C, 20°C, 25°C, 30°CWestern blot of time course samples
Inducer concentration0.01-1.0 mM IPTG or 0.002-0.2% arabinoseSDS-PAGE of total vs. membrane fraction
Media compositionLB, TB, M9, autoinductionMembrane yield and target protein content
Induction timingEarly, mid, late log phaseGrowth curves and expression level
AdditivesGlycerol, specific lipids, membrane stabilizersFunctional assays of expressed protein
  • Extraction and purification optimization:

    • Implement high-throughput detergent screening

    • Test alternative solubilization methods (SMALPs, nanodiscs)

    • Optimize buffer components for stability

    • Implement on-column detergent exchange

  • Quality control integration:

    • Develop rapid folding assays to guide optimization

    • Implement in-process monitoring of protein quality

    • Use GFP fusion reporters to monitor folding in real-time

    • Apply thermal shift assays to assess stability improvements

This methodical approach addresses the multiple factors that influence successful expression of challenging membrane proteins for structural studies.

What protocols produce the most reliable reconstitution of YobD into membrane mimetics for functional studies?

Reliable reconstitution of YobD requires systematic optimization of multiple parameters:

  • Selection of appropriate membrane mimetic:

Membrane MimeticAdvantagesDisadvantagesBest Applications
LiposomesNative bilayer environmentHeterogeneous sizeFunctional transport assays
NanodiscsDefined size, accessible surfacesComplex assemblyInteraction studies
BicellesMagnetically alignableLimited stabilityNMR structural studies
AmphipolsStability in detergent-free solutionsNon-native environmentCryo-EM studies
  • Lipid composition optimization:

    • Screen natural E. coli lipid extracts vs. synthetic lipid mixtures

    • Test varying ratios of PC, PE, PG, and cardiolipin

    • Evaluate cholesterol or ergosterol incorporation effects

    • Consider native lipids from Salmonella membranes

  • Reconstitution methodology:

    • Detergent removal techniques:

      • Dialysis (slow, gentle)

      • Bio-beads adsorption (controlled rate)

      • Cyclodextrin complexation (rapid)

      • Dilution method (simple but lower efficiency)

    • Physical parameter control:

      • Temperature during reconstitution

      • Protein-to-lipid ratios (typically 1:100 to 1:1000)

      • Buffer ionic strength and pH

      • Presence of stabilizing additives

  • Quality control methods:

    • Freeze-fracture electron microscopy to assess distribution

    • Dynamic light scattering for size distribution

    • Sucrose density gradients to verify incorporation

    • Protease protection assays to confirm orientation

  • Functional validation:

    • Specific activity measurements in the reconstituted system

    • Comparison with native membrane activity

    • Stability assessment over time

    • Structural integrity verification by spectroscopic methods

For NMR studies specifically, the five-step approach described in research emphasizes the importance of uniformly 13C/15N labeled YobD reconstituted into proteoliposomes with optimized conditions for spectral quality .

How can researchers design definitive experiments to determine YobD's role in Salmonella virulence?

Designing definitive experiments for YobD virulence studies requires rigorous methodology:

  • Genetic manipulation strategies:

    • Clean deletion mutants (unmarked, in-frame)

    • Complementation controls (chromosomal, single-copy)

    • Point mutations targeting specific functional domains

    • Regulated expression systems to titrate YobD levels

    • Tagged variants for localization studies

  • In vitro infection model matrix:

Cell TypeParameters to MeasureControls Required
Epithelial cellsAdhesion, invasion, intracellular survivalInvasion-deficient controls (ΔinvA)
MacrophagesPhagocytosis, survival, replicationKnown survival mutants (ΔphoP)
Dendritic cellsAntigen presentation, cytokine responseImmunomodulation controls
Intestinal organoidsTissue-level responses, barrier functionMultiple genetic backgrounds
  • In vivo infection approaches:

    • Multiple animal models with different susceptibilities

    • Competitive index assays (wild-type vs. mutant)

    • Tissue-specific bacterial burden determination

    • Immune response characterization

    • Long-term colonization assessment

  • Molecular mechanism investigations:

    • Transcriptomic analysis of host and bacterial responses

    • Metabolomic profiling using GCxGC/TOFMS as described in research

    • Protein-protein interaction mapping

    • Membrane integrity and function assessment

  • Systems biology integration:

    • Multi-omics data integration

    • Network analysis of affected pathways

    • Mathematical modeling of host-pathogen interaction

    • Machine learning approaches to identify key virulence signatures

This comprehensive experimental framework provides multiple lines of evidence to definitively establish YobD's role in Salmonella virulence through complementary approaches and rigorous controls.

What are the most sensitive analytical methods for detecting conformational changes in YobD upon ligand binding?

Multiple biophysical techniques can detect YobD conformational changes with varying sensitivity:

  • Spectroscopic approaches:

    • Circular dichroism (CD) spectroscopy for secondary structure changes

    • Fluorescence spectroscopy with intrinsic tryptophan or introduced fluorophores

    • FTIR spectroscopy for hydrogen bonding network alterations

    • EPR spectroscopy with site-directed spin labeling for domain movement

  • NMR-based methods:

    • Chemical shift perturbation mapping in solution NMR

    • Solid-state NMR frequency changes in reconstituted systems

    • Hydrogen-deuterium exchange rates for accessibility changes

    • Relaxation dispersion measurements for microsecond-millisecond dynamics

  • Thermodynamic and hydrodynamic techniques:

    • Isothermal titration calorimetry (ITC) for binding energetics

    • Differential scanning calorimetry (DSC) for stability changes

    • Analytical ultracentrifugation for shape and oligomerization changes

    • Size exclusion chromatography coupled with multi-angle light scattering

  • Single-molecule approaches:

    • FRET with strategically placed fluorophores

    • Atomic force microscopy for topography changes

    • Single-molecule force spectroscopy for unfolding energy landscapes

    • Nanopore analysis for conductance changes

  • Structural biology integration:

    • Time-resolved structural methods (TR-NMR, TR-crystallography)

    • Cryo-EM of ligand-bound vs. unbound states

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Cross-linking mass spectrometry (XL-MS) for distance constraint changes

For membrane proteins specifically, solid-state NMR approaches as described in research offer particular advantages in detecting subtle conformational changes in membrane environments, as they can measure orientation-dependent frequencies that directly reflect structural changes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.