The Recombinant Salmonella paratyphi C UPF0266 membrane protein yobD (yobD) is a recombinant protein derived from the bacterium Salmonella paratyphi C. This protein is part of a broader class of proteins known as UPF0266 membrane proteins, which are encoded by the yobD gene. The recombinant form of this protein is produced using in vitro expression systems, typically in Escherichia coli (E. coli), to facilitate its study and application in various biomedical research contexts.
Sequence and Structure: The protein sequence of UPF0266 membrane protein yobD from Salmonella paratyphi C consists of a specific amino acid arrangement that defines its structure and function. The sequence is MTITDLLLILFIAALLAYALYDQFIMPRRNGPTLLSIALLRRGRVDSVIFVGLVAILIYN NVTSHGAQMTTWLLSALALMGFYIFWIRTPRIIFKQRGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLIENQ .
Function: While specific functions of the yobD protein are not extensively detailed in the literature, membrane proteins generally play roles in cell signaling, transport, and interaction with the environment.
Production: The recombinant protein is produced in E. coli using in vitro expression systems. This involves transforming E. coli cells with a plasmid encoding the yobD gene, followed by protein expression and purification .
Purification: The purification process typically involves affinity purification methods to achieve high purity levels.
Vaccine Development: While specific applications of the yobD protein in vaccine development are not detailed, membrane proteins from Salmonella species are being explored for their potential in eliciting immune responses .
Diagnostic Tools: Recombinant proteins like yobD can be used in diagnostic assays such as Western blotting (WB) and enzyme-linked immunosorbent assay (ELISA) to detect antibodies against Salmonella paratyphi C .
Genomic Analysis: The study of Salmonella paratyphi C proteins, including yobD, contributes to understanding the genomic diversity and population structure of this pathogen. This knowledge can inform public health strategies and epidemiological tracking .
Protein-Protein Interactions: Further research on the interactions of yobD with other proteins could reveal insights into its role in bacterial pathogenesis and survival.
| Process | Description |
|---|---|
| Expression System | In vitro E. coli expression |
| Purification Method | Affinity purification |
| Purity | Not specified for this particular protein, but generally high |
KEGG: sei:SPC_1896
Salmonella paratyphi C is one of the serovars of Salmonella enterica that causes paratyphoid fever in humans. Salmonella enterica serovars Paratyphi A, B (tartrate negative), and C are identified as etiologic agents of Salmonella Paratyphi infections . While sharing some characteristics with other Paratyphi serovars, S. paratyphi C has distinct genomic features and epidemiological patterns.
The infection process typically involves ingestion of food or water contaminated with the stool or urine of a carrier. Most cases of paratyphoid fever are acquired during international travel to endemic regions including parts of Asia, Africa, and Latin America . The incubation period typically ranges from 1 to 10 days, and the disease remains communicable as long as paratyphoid bacilli are present in excreta .
Clinical presentations include sustained fever, headache, malaise, anorexia, relative bradycardia, and varying gastrointestinal symptoms, though mild and atypical infections may also occur . Unlike some other Salmonella species, S. paratyphi has humans as its only known reservoir.
The UPF0266 membrane protein YobD in Salmonella paratyphi C belongs to a family of uncharacterized proteins found in bacterial membranes. As a membrane protein, structural analysis requires specialized techniques such as those outlined in the five-step approach for membrane protein structure determination:
Preparation of uniformly 13C/15N labeled protein in proteoliposomes
Resolution of individual signals using Magic Angle Spinning (MAS) solid-state NMR
Assignment of signals to specific residues
Measurement of orientation-dependent frequencies and distance restraints
The significance of YobD lies in its potential role in bacterial membrane function, which could impact pathogenesis, survival mechanisms, or antimicrobial resistance. Understanding its structure-function relationship provides insights into basic bacterial physiology and potential therapeutic targets.
Multiple expression systems should be evaluated when working with membrane proteins like YobD:
When selecting an expression system, consider:
For structural studies specifically, the solid-state NMR approach requires uniformly 13C/15N labeled protein, necessitating expression in minimal media with labeled precursors .
A multi-technique approach is essential for validating recombinant YobD protein:
Biochemical identification:
SDS-PAGE for size verification and initial purity assessment
Western blotting with tag-specific or YobD-specific antibodies
Mass spectrometry for precise mass determination and sequence verification
N-terminal sequencing to confirm proper processing
Structural integrity assessment:
Circular dichroism to evaluate secondary structure elements
Fluorescence spectroscopy to assess tertiary structure
Thermal stability assays to determine protein folding quality
Limited proteolysis to identify properly folded domains
Homogeneity analysis:
Size exclusion chromatography to assess oligomeric state
Dynamic light scattering for polydispersity measurement
Analytical ultracentrifugation for precise molecular weight determination
Native gel electrophoresis for non-denatured size analysis
Functional validation:
Lipid binding assays to verify membrane interaction capabilities
Reconstitution into liposomes to assess membrane insertion
Activity assays based on predicted functions (if known)
For membrane proteins specifically, additional considerations include detergent screening to maintain native-like structure and assessing protein-lipid interactions that may be essential for function.
Optimizing YobD isolation requires systematic evaluation of each purification step:
Membrane fraction isolation:
Gentle cell lysis methods to preserve membrane integrity (e.g., enzymatic lysis, French press at moderate pressure)
Differential centrifugation to separate membrane fractions (e.g., 5,000×g to remove debris, followed by 100,000×g to collect membranes)
Multiple washing steps with high salt buffers (300-500 mM NaCl) to remove peripheral proteins
Solubilization optimization:
Systematic detergent screening using the matrix approach:
| Detergent Class | Examples | Optimal Concentration | Best Applications |
|---|---|---|---|
| Mild Non-ionic | DDM, LMNG | 1-2% for extraction, 0.05-0.1% for purification | Structure studies |
| Zwitterionic | LDAO, FC-12 | 0.5-1% for extraction, 0.05% for purification | High extraction efficiency |
| Newer Amphipathic | SMA, amphipols | 2.5% SMA polymer | Native lipid environment retention |
Chromatographic purification:
Immobilized metal affinity chromatography (IMAC) for His-tagged constructs
On-column detergent exchange during washing steps
Size exclusion chromatography as final polishing step
Monitoring protein quality at each step via activity or structural assays
Sample concentration considerations:
Careful concentration using centrifugal devices with appropriate molecular weight cutoffs
Addition of glycerol (10-15%) to prevent aggregation
Adjustment of critical micelle concentration (CMC) of detergents during concentration
The structural analysis approach described in search results emphasizes the importance of reconstituting purified YobD into proteoliposomes for solid-state NMR studies, requiring careful optimization of lipid composition and protein-to-lipid ratios .
Solid-state NMR structure determination of membrane proteins like YobD faces several technical challenges:
Sample preparation complexities:
Achieving homogeneous reconstitution in proteoliposomes
Optimizing protein-to-lipid ratios for spectral quality
Ensuring complete isotopic labeling (13C/15N) for multidimensional experiments
Maintaining protein stability during extended data acquisition periods
Spectroscopic challenges:
Data analysis and interpretation:
Complex assignment strategies for membrane protein spectra
Extraction of structural restraints from orientation-dependent frequencies
Integration of distance and angular constraints into structure calculations
Computational demands of structure refinement
As outlined in the research literature, a comprehensive approach requires:
High-field NMR spectrometers (700-750 MHz or higher)
Specialized probes for solid-state experiments (e.g., 3.2 mm low-E triple resonance probes)
Two- and three-dimensional separated local field (SLF) experiments for angular constraints
Integration of multiple NMR parameters into structure calculations
The optimization process typically requires iterative refinement of sample conditions, pulse sequences, and data analysis methods to achieve sufficient resolution for structure determination.
Metabolomic analysis provides valuable insights into YobD function through the detection of altered metabolite profiles:
Experimental design considerations:
Comparison between wild-type and YobD knockout strains
Analysis of host cell responses to infection with each strain
Time-course studies to capture dynamic metabolic changes
Integration with transcriptomic data for pathway analysis
Analytical techniques:
Two-dimensional gas chromatography with time-of-flight mass spectrometry (GCxGC/TOFMS) has proven effective for detecting metabolite signals in Salmonella infections
The approach can identify hundreds of individual metabolite peaks (695 in one study) with high sensitivity
Supervised pattern recognition methods can identify significant metabolite profiles that distinguish between different infection states
Data analysis strategies:
Research on Salmonella Typhi and Paratyphi A has demonstrated that a combination of just six metabolites (ethanolamine, gluconic acid, monosaccharide, phenylalanine, pipecolic acid, and saccharide) can provide high discriminatory power between infection states, suggesting similar approaches could reveal YobD's metabolic impact .
Resolving contradictory findings requires systematic methodological approaches:
Standardization of experimental systems:
Establish reference strains and constructs
Define precise genetic modifications (clean deletions vs. insertional inactivation)
Standardize culture conditions and growth phases
Use multiple infection models with defined parameters
Multi-level phenotypic analysis:
Conduct comprehensive virulence testing in multiple models
Perform detailed in vitro phenotypic characterization
Analyze subcellular localization under identical conditions
Examine protein-protein interactions systematically
Molecular genetic approaches:
Create allelic series with point mutations targeting specific domains
Perform complementation with homologs from related species
Use controlled expression systems to determine dose-dependency
Construct reporter fusions to monitor expression in different conditions
Data integration framework:
Implement meta-analysis of published and unpublished data
Establish a standardized database of YobD experimental results
Develop mathematical models to reconcile apparently contradictory observations
Adopt Bayesian approaches to weigh evidence from different methodologies
Collaborative resolution strategies:
Organize multi-laboratory studies with standardized protocols
Implement round-robin testing of key findings
Establish a consortium approach for comprehensive phenotyping
Develop consensus reporting standards for YobD research
This systematic approach can reconcile contradictory findings by identifying condition-dependent effects and methodological variables that influence experimental outcomes.
Multiple complementary techniques should be employed to determine YobD membrane topology:
Biochemical mapping approaches:
Cysteine scanning mutagenesis with selective labeling of accessible residues
Protease protection assays with site-specific proteases
Chemical modification accessibility studies
Glycosylation mapping with engineered sites
Genetic fusion strategies:
Reporter fusions (PhoA, LacZ, GFP) at different positions
Dual reporter constructs to distinguish cytoplasmic vs. periplasmic locations
Systematic truncation analysis with terminal reporters
Split protein complementation to identify membrane-spanning segments
Spectroscopic methods:
Oriented Sample (OS) solid-state NMR to determine angular constraints
Site-directed spin labeling with EPR spectroscopy
FRET analysis with strategically placed fluorophores
Hydrogen-deuterium exchange mass spectrometry
Computational integration:
Topology prediction algorithms (TMHMM, TOPCONS)
Integration of experimental data with computational models
Molecular dynamics simulations in membrane environments
Evolutionary analysis of conserved topology features
Structural validation:
The five-step NMR approach described in research provides angular constraints that directly define orientation
Two- and three-dimensional separated local field (SLF) spectra resolve orientation-dependent frequencies
These frequencies translate directly into angular constraints for structure calculation
The integration of these approaches provides a robust characterization of YobD's membrane topology and orientation, essential for understanding its functional mechanisms.
A systematic multi-method approach is required to identify YobD interaction partners:
Proximity-based identification methods:
In vivo crosslinking followed by mass spectrometry
BioID or APEX2 proximity labeling
Split-protein complementation assays
Resonance energy transfer approaches (FRET/BRET)
Affinity-based approaches:
Co-immunoprecipitation with quantitative proteomics
Tandem affinity purification with gentle solubilization
Pull-down assays with recombinant YobD as bait
Yeast two-hybrid using membrane yeast two-hybrid variants
Genetic and functional screening:
Suppressor screens to identify functional partners
Synthetic genetic array analysis for genetic interactions
Transcriptional response profiling after YobD perturbation
Chemical genetic profiling to identify functional pathways
Computational prediction and validation:
Machine learning approaches for interaction prediction
Co-evolution analysis to identify potential binding interfaces
Molecular docking simulations with candidate partners
Network analysis of protein-protein interaction databases
Validation and characterization:
The combination of these approaches provides a comprehensive strategy for identifying and validating YobD interaction partners in both bacterial and host cellular contexts.
Optimizing NMR parameters for YobD structural studies requires attention to several technical aspects:
| NMR Technique | Key Parameters | Sample Requirements | Information Obtained |
|---|---|---|---|
| MAS Solid-state NMR | 10-14 kHz spinning rate, >700 MHz field | Uniformly 13C/15N labeled protein in proteoliposomes | Isotropic chemical shifts, distance constraints |
| OS Solid-state NMR | No spinning, >700 MHz field | Aligned samples on glass plates | Angular constraints |
| 2D/3D SLF Spectra | Long acquisition times, multiple-pulse sequences | Isotopically labeled samples | Residue-specific assignments |
| Distance Measurements | Dipolar recoupling sequences | Specifically labeled samples | Tertiary structure constraints |
As described in the research literature, optimal experimental conditions include:
Instrumentation requirements:
Pulse sequence optimization:
Separated local field (SLF) experiments for resolving orientation-dependent frequencies
Multiple-quantum coherence experiments for improved resolution
Dipolar recoupling sequences for distance measurements
Temperature compensation in pulse programs
Sample optimization:
Protein-to-lipid ratios typically 1:50 to 1:100
Hydration levels carefully controlled
Sample temperature maintained above lipid phase transition
Buffer conditions optimized for protein stability
Data acquisition strategies:
Non-uniform sampling for multidimensional experiments
Long experimental times (days to weeks) for complete datasets
Multiple complementary experiments for cross-validation
These parameters must be empirically optimized for each specific membrane protein system to achieve the resolution required for structure determination .
Overcoming expression challenges for YobD requires a systematic troubleshooting approach:
Genetic construct optimization:
Screen multiple construct boundaries to identify stable domains
Test various affinity and solubility tags (His6, MBP, SUMO, Trx)
Optimize codon usage for expression host
Consider synthetic gene design with optimized mRNA folding
Remove potential toxic elements (internal promoters, RBS sites)
Expression system selection:
Test multiple E. coli strains specialized for membrane proteins (C41/C43, Lemo21)
Evaluate eukaryotic systems for complex membrane proteins (Pichia, insect cells)
Consider cell-free expression systems for direct incorporation into lipid environments
Use dual-plasmid systems with chaperones or membrane insertion machinery
Culture condition optimization matrix:
| Parameter | Variables to Test | Monitoring Method |
|---|---|---|
| Temperature | 16°C, 20°C, 25°C, 30°C | Western blot of time course samples |
| Inducer concentration | 0.01-1.0 mM IPTG or 0.002-0.2% arabinose | SDS-PAGE of total vs. membrane fraction |
| Media composition | LB, TB, M9, autoinduction | Membrane yield and target protein content |
| Induction timing | Early, mid, late log phase | Growth curves and expression level |
| Additives | Glycerol, specific lipids, membrane stabilizers | Functional assays of expressed protein |
Extraction and purification optimization:
Implement high-throughput detergent screening
Test alternative solubilization methods (SMALPs, nanodiscs)
Optimize buffer components for stability
Implement on-column detergent exchange
Quality control integration:
Develop rapid folding assays to guide optimization
Implement in-process monitoring of protein quality
Use GFP fusion reporters to monitor folding in real-time
Apply thermal shift assays to assess stability improvements
This methodical approach addresses the multiple factors that influence successful expression of challenging membrane proteins for structural studies.
Reliable reconstitution of YobD requires systematic optimization of multiple parameters:
Selection of appropriate membrane mimetic:
| Membrane Mimetic | Advantages | Disadvantages | Best Applications |
|---|---|---|---|
| Liposomes | Native bilayer environment | Heterogeneous size | Functional transport assays |
| Nanodiscs | Defined size, accessible surfaces | Complex assembly | Interaction studies |
| Bicelles | Magnetically alignable | Limited stability | NMR structural studies |
| Amphipols | Stability in detergent-free solutions | Non-native environment | Cryo-EM studies |
Lipid composition optimization:
Screen natural E. coli lipid extracts vs. synthetic lipid mixtures
Test varying ratios of PC, PE, PG, and cardiolipin
Evaluate cholesterol or ergosterol incorporation effects
Consider native lipids from Salmonella membranes
Reconstitution methodology:
Detergent removal techniques:
Dialysis (slow, gentle)
Bio-beads adsorption (controlled rate)
Cyclodextrin complexation (rapid)
Dilution method (simple but lower efficiency)
Physical parameter control:
Temperature during reconstitution
Protein-to-lipid ratios (typically 1:100 to 1:1000)
Buffer ionic strength and pH
Presence of stabilizing additives
Quality control methods:
Freeze-fracture electron microscopy to assess distribution
Dynamic light scattering for size distribution
Sucrose density gradients to verify incorporation
Protease protection assays to confirm orientation
Functional validation:
Specific activity measurements in the reconstituted system
Comparison with native membrane activity
Stability assessment over time
Structural integrity verification by spectroscopic methods
For NMR studies specifically, the five-step approach described in research emphasizes the importance of uniformly 13C/15N labeled YobD reconstituted into proteoliposomes with optimized conditions for spectral quality .
Designing definitive experiments for YobD virulence studies requires rigorous methodology:
Genetic manipulation strategies:
Clean deletion mutants (unmarked, in-frame)
Complementation controls (chromosomal, single-copy)
Point mutations targeting specific functional domains
Regulated expression systems to titrate YobD levels
Tagged variants for localization studies
In vitro infection model matrix:
| Cell Type | Parameters to Measure | Controls Required |
|---|---|---|
| Epithelial cells | Adhesion, invasion, intracellular survival | Invasion-deficient controls (ΔinvA) |
| Macrophages | Phagocytosis, survival, replication | Known survival mutants (ΔphoP) |
| Dendritic cells | Antigen presentation, cytokine response | Immunomodulation controls |
| Intestinal organoids | Tissue-level responses, barrier function | Multiple genetic backgrounds |
In vivo infection approaches:
Multiple animal models with different susceptibilities
Competitive index assays (wild-type vs. mutant)
Tissue-specific bacterial burden determination
Immune response characterization
Long-term colonization assessment
Molecular mechanism investigations:
Systems biology integration:
Multi-omics data integration
Network analysis of affected pathways
Mathematical modeling of host-pathogen interaction
Machine learning approaches to identify key virulence signatures
This comprehensive experimental framework provides multiple lines of evidence to definitively establish YobD's role in Salmonella virulence through complementary approaches and rigorous controls.
Multiple biophysical techniques can detect YobD conformational changes with varying sensitivity:
Spectroscopic approaches:
Circular dichroism (CD) spectroscopy for secondary structure changes
Fluorescence spectroscopy with intrinsic tryptophan or introduced fluorophores
FTIR spectroscopy for hydrogen bonding network alterations
EPR spectroscopy with site-directed spin labeling for domain movement
NMR-based methods:
Chemical shift perturbation mapping in solution NMR
Solid-state NMR frequency changes in reconstituted systems
Hydrogen-deuterium exchange rates for accessibility changes
Relaxation dispersion measurements for microsecond-millisecond dynamics
Thermodynamic and hydrodynamic techniques:
Isothermal titration calorimetry (ITC) for binding energetics
Differential scanning calorimetry (DSC) for stability changes
Analytical ultracentrifugation for shape and oligomerization changes
Size exclusion chromatography coupled with multi-angle light scattering
Single-molecule approaches:
FRET with strategically placed fluorophores
Atomic force microscopy for topography changes
Single-molecule force spectroscopy for unfolding energy landscapes
Nanopore analysis for conductance changes
Structural biology integration:
Time-resolved structural methods (TR-NMR, TR-crystallography)
Cryo-EM of ligand-bound vs. unbound states
Hydrogen-deuterium exchange mass spectrometry (HDX-MS)
Cross-linking mass spectrometry (XL-MS) for distance constraint changes
For membrane proteins specifically, solid-state NMR approaches as described in research offer particular advantages in detecting subtle conformational changes in membrane environments, as they can measure orientation-dependent frequencies that directly reflect structural changes .