Recombinant Salmonella paratyphi C Zinc transport protein ZntB (zntB)

What is ZntB protein in Salmonella paratyphi C?

ZntB (Zinc transport protein B) in Salmonella paratyphi C is a 327-amino acid transmembrane protein involved in zinc transport across bacterial cell membranes. It serves as a zinc efflux system that helps maintain appropriate intracellular zinc levels, protecting bacteria from zinc toxicity. The protein belongs to the CorA family of cation transporters, though it specifically functions in zinc transport rather than magnesium transport like most other members of this family. ZntB can be recombinantly expressed with an N-terminal His-tag to facilitate purification and experimental studies without compromising its functional properties .

The complete amino acid sequence of Salmonella paratyphi C ZntB consists of 327 residues with multiple hydrophobic regions that form transmembrane domains. As documented in protein databases, ZntB has the UniProt ID C0Q3V4 and is also known by synonyms including SPC_2078 . Molecular characterization indicates that ZntB likely forms a multimeric complex in the membrane, creating a pore through which zinc ions can be transported out of the bacterial cell.

What is the function of ZntB in bacterial cells?

ZntB functions primarily as a zinc efflux transporter in bacterial cells, playing a crucial role in maintaining zinc homeostasis. Studies in Salmonella enterica have demonstrated that ZntB facilitates the removal of excess intracellular zinc, which is essential for preventing zinc toxicity while ensuring sufficient zinc remains available for essential metabolic processes . When the zntB gene is disrupted through mutation, bacteria show increased sensitivity to zinc and cadmium, providing strong evidence for its role in metal ion efflux .

Transport assays with radioisotope-labeled zinc (65Zn2+) have directly confirmed ZntB's function in zinc efflux. Experimental data shows that bacterial strains with functional ZntB demonstrate significantly higher rates of zinc efflux compared to strains with disrupted zntB genes . The protein's activity becomes particularly important under conditions of elevated environmental zinc levels, where efficient efflux is necessary to prevent toxic zinc accumulation. Unlike some other zinc transporters that require ATP hydrolysis, ZntB appears to facilitate zinc transport through a different mechanism, potentially utilizing concentration gradients across the membrane .

How does ZntB relate to bacterial zinc homeostasis?

ZntB operates as part of a sophisticated network of zinc transporters and regulatory proteins that collectively maintain appropriate zinc levels within bacterial cells. Zinc homeostasis is critical because zinc serves as an essential cofactor for hundreds of enzymes while becoming toxic at excessive concentrations. ZntB contributes to this homeostasis by providing an efflux pathway that removes excess zinc from the cytoplasm .

Experimental evidence demonstrates that disruption of the zntB gene increases bacterial sensitivity to zinc, with mutant strains displaying reduced growth in zinc-supplemented media compared to wild-type strains. Specifically, zntB mutants show half-maximal growth at zinc concentrations around 20 μM, while wild-type strains can maintain half-maximal growth at approximately 60 μM zinc . These findings indicate that ZntB provides significant protection against zinc toxicity, particularly under elevated zinc conditions.

ZntB likely works in coordination with other zinc transporters, including uptake systems (like ZnuABC) and additional efflux systems (like ZntA), to maintain optimal zinc homeostasis. The protein's widespread conservation across bacterial species further emphasizes its fundamental importance in bacterial physiology and metal ion regulation .

What are the key molecular features of recombinant ZntB protein?

Recombinant ZntB protein from Salmonella paratyphi C encompasses the full-length sequence of 327 amino acids (residues 1-327) and can be effectively expressed in E. coli expression systems . When produced with an N-terminal His-tag, the protein can be purified using affinity chromatography techniques, yielding preparations with greater than 90% purity as determined by SDS-PAGE analysis . The protein's amino acid sequence contains multiple hydrophobic regions that form transmembrane domains essential for creating the zinc transport pathway across the bacterial membrane.

Key molecular features of ZntB include:

For research applications, the recombinant protein is typically stored as a lyophilized powder and requires reconstitution before use . Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and transport function. Addition of 5-50% glycerol to reconstituted protein is recommended for long-term storage to maintain structural stability and functional activity .

How is ZntB structurally related to other metal transporters?

ZntB belongs to the CorA family of cation transporters, which represents an interesting evolutionary relationship since most members of this family transport magnesium rather than zinc . This structural relationship provides valuable insights into how transport proteins can evolve different substrate specificities while maintaining similar structural frameworks. The CorA family is widely distributed among bacteria and archaea, with ZntB homologs found across diverse bacterial species .

The functional divergence of ZntB from the typical magnesium transport activity of CorA family members represents an excellent example of how evolutionary processes can repurpose existing protein architectures for new functions. The zinc transport activity of ZntB assigns a new function to the CorA family of cation transporters, expanding our understanding of the versatility of this protein family .

What experimental evidence confirms ZntB's role in zinc transport?

Multiple experimental approaches have provided strong evidence for ZntB's role in zinc transport:

• Genetic Evidence: Disruption of the zntB gene in Salmonella enterica increases bacterial sensitivity to zinc and cadmium, as demonstrated by disk diffusion assays. Wild-type strains show smaller zones of growth inhibition around zinc-containing disks compared to zntB mutants, indicating that the protein contributes to zinc resistance . Complementation experiments with plasmid-encoded wild-type zntB partially restore zinc resistance in mutant strains, confirming that the observed phenotype is specifically due to loss of ZntB function .

• Growth Inhibition Studies: Comparative growth analysis in media containing varying zinc concentrations shows that zntB mutants display reduced growth at lower zinc concentrations compared to wild-type strains. Wild-type Salmonella shows half-maximal growth at approximately 60 μM zinc, while zntB mutants reach half-maximal growth at only 20 μM zinc . This three-fold difference in zinc tolerance directly links ZntB to zinc resistance mechanisms.

• Radioisotope Transport Assays: Direct measurement of zinc transport using 65Zn2+ demonstrates that ZntB facilitates zinc efflux. In transport-deficient E. coli strains, expression of ZntB increases the rate of 65Zn2+ efflux by 8.8-fold compared to control strains . This provides the most direct evidence that ZntB functions as a zinc efflux pathway.

These complementary experimental approaches collectively establish ZntB as a bona fide zinc transporter with particular importance in zinc efflux and detoxification .

How can recombinant ZntB be expressed and purified for research use?

The expression and purification of recombinant ZntB for research applications involves several critical steps:

• Cloning and Expression Vector Construction:

  • The full-length zntB gene (encoding 327 amino acids) is amplified from Salmonella paratyphi C genomic DNA and cloned into an expression vector with an N-terminal His-tag .

  • The expression construct should be verified by sequencing to confirm the correct reading frame and absence of mutations.

• Expression in E. coli:

  • Transform the validated expression construct into a suitable E. coli strain such as BL21(DE3) .

  • Grow transformed cells in appropriate media with antibiotics at 37°C until reaching mid-log phase.

  • Induce protein expression with IPTG and continue cultivation at a reduced temperature (typically 16-25°C) to enhance proper folding of the membrane protein.

• Cell Harvesting and Lysis:

  • Harvest cells by centrifugation and resuspend in lysis buffer containing protease inhibitors.

  • Disrupt cells using sonication, high-pressure homogenization, or other suitable methods.

  • Remove cell debris by centrifugation at high speed (typically >20,000 × g).

• Affinity Purification:

  • Apply the clarified lysate to a Ni-NTA affinity column pre-equilibrated with appropriate buffer.

  • Wash the column to remove non-specifically bound proteins.

  • Elute His-tagged ZntB using an imidazole gradient or high imidazole concentration .

• Quality Control and Storage:

  • Verify protein purity by SDS-PAGE (>90% purity is recommended for most applications) .

  • Concentrate and buffer-exchange into storage buffer (Tris/PBS-based buffer with 6% trehalose, pH 8.0) .

  • Aliquot to avoid repeated freeze-thaw cycles and store at -20°C/-80°C for long-term stability .

For reconstitution of lyophilized protein, it is recommended to briefly centrifuge the vial before opening to collect all material at the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and for optimal stability, add 5-50% glycerol before aliquoting for long-term storage .

What methods can be used to measure ZntB transport activity?

Several complementary methods can be employed to measure ZntB transport activity:

• Radioisotope Transport Assays:

  • 65Zn2+ efflux measurements: Cells or membrane vesicles are preloaded with 65Zn2+, and the rate of zinc release into the external medium is measured over time .

  • The presence of functional ZntB significantly increases efflux rates compared to control strains lacking ZntB or containing inactive mutants .

  • This direct approach provides the most conclusive evidence of transport activity and can be quantified precisely.

• Zinc Accumulation Studies:

  • Comparing total zinc accumulation between wild-type and zntB mutant strains under various external zinc concentrations.

  • zntB mutants typically accumulate more zinc than wild-type strains, consistent with reduced efflux capacity .

  • Total zinc content can be measured using atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS).

• Growth Inhibition Assays:

  • Comparing growth of wild-type and zntB mutant strains in media containing varying concentrations of zinc.

  • Growth curves are generated to determine the concentration at which growth is inhibited by 50% (IC50).

  • Wild-type strains with functional ZntB typically show higher IC50 values than zntB mutants .

• Disk Diffusion Assays:

  • Filter disks containing zinc solutions are placed on bacterial lawns.

  • The zone of growth inhibition is measured and compared between strains with and without functional ZntB.

  • This method provides a simple visual assessment of zinc sensitivity differences .

• Complementation Studies:

  • Introducing plasmid-encoded wild-type zntB into mutant strains and measuring restoration of transport activity or zinc resistance.

  • This approach confirms that observed phenotypes are specifically due to the absence of ZntB rather than secondary mutations .

These methods provide complementary information about ZntB function, with radioisotope transport assays offering the most direct evidence of transport activity while growth-based assays demonstrate physiological relevance.

How can researchers create and characterize zntB mutants?

Creating and characterizing zntB mutants is essential for understanding the protein's function and involves several methodological approaches:

• Generation of zntB Mutants:

  • Allelic replacement strategy: The wild-type zntB gene can be disrupted by inserting an antibiotic resistance cassette (such as chloramphenicol resistance) into the coding sequence .

  • The disrupted gene is introduced into the bacterial chromosome via homologous recombination, replacing the native gene.

  • This approach has been successfully used to create zntB mutants in Salmonella enterica, resulting in strain RS1100 .

• Verification of Mutant Construction:

  • PCR amplification with primers flanking the insertion site to confirm the presence of the disruption.

  • Bacteriophage P22-mediated cotransduction can be used to map the position of the insertion and confirm its linkage to nearby genetic markers .

  • In Salmonella enterica, the zntB gene maps to centisome 36 and shows 100% linkage to oxrA (fnr), consistent with genome sequence data .

• Phenotypic Characterization:

  • Metal sensitivity testing: Disk diffusion assays using zinc, cadmium, and other metals can reveal increased sensitivity in mutant strains .

  • Growth curve analysis in media containing varying concentrations of zinc provides quantitative assessment of zinc tolerance .

  • Transport assays with 65Zn2+ directly measure changes in zinc efflux capacity .

• Complementation Analysis:

  • Introduction of plasmid-encoded wild-type zntB into the mutant strain should restore zinc resistance if the phenotype is specifically due to zntB disruption .

  • Partial complementation (as observed with strain RS1100/pAJW54) confirms the role of ZntB in zinc resistance while suggesting that expression levels or regulation may differ from the native configuration .

• Site-Directed Mutagenesis:

  • Creating specific amino acid substitutions in conserved residues can identify residues critical for transport function or substrate specificity.

  • Mutations in predicted metal-binding sites can help elucidate the mechanism of zinc recognition and transport.

This systematic approach to mutant creation and characterization has been instrumental in establishing ZntB's role in zinc efflux and bacterial metal homeostasis .

How does ZntB function differ from other zinc transporters?

ZntB represents a unique zinc transport system that differs from other zinc transporters in several important aspects:

Understanding these functional differences is crucial for developing a comprehensive model of bacterial zinc homeostasis and for potentially targeting ZntB in antimicrobial strategies .

What is known about the structure-function relationship in ZntB?

While high-resolution structural data specifically for Salmonella paratyphi C ZntB is currently limited, several aspects of its structure-function relationship can be inferred from experimental data and homology to related proteins:

• Membrane Topology and Organization:

  • Based on homology to CorA family members, ZntB likely forms a homopentameric complex with a central pore through which zinc ions are transported .

  • The protein contains multiple transmembrane domains that create the transport pathway across the bacterial membrane.

  • The N-terminal domain is likely cytoplasmic and may be involved in zinc sensing or regulation of transport activity.

• Metal Binding Sites:

  • Key amino acid residues (likely including histidine, cysteine, or aspartate) form binding sites that confer specificity for zinc over magnesium.

  • The evolution of zinc specificity from a magnesium transporter ancestor likely involved substitutions in these metal-coordinating residues.

  • Mutations in these binding sites would be expected to alter transport kinetics or substrate specificity.

• Functional Domains:

  • The transmembrane domains form the core transport pathway and likely undergo conformational changes during the transport cycle.

  • The amino acid sequence of ZntB (MEAIKGSDVNVPDAVFAWLLDGHGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR QRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIGGVTLWLHRSKWL) contains regions characteristic of the CorA family .

• Structure-Based Transport Mechanism:

  • The transport mechanism likely involves binding of zinc ions at specific sites, followed by conformational changes that alter the accessibility of these sites from one side of the membrane to the other.

  • The pentameric organization creates a central pore that likely serves as the zinc conduction pathway.

Further structural studies using techniques such as X-ray crystallography or cryo-electron microscopy would significantly advance our understanding of how ZntB's structure enables its function as a zinc efflux transporter .

How might ZntB contribute to bacterial pathogenesis?

ZntB's role in zinc homeostasis has important implications for bacterial pathogenesis, particularly for Salmonella species:

• Resistance to Host Zinc Toxicity:

  • During infection, host cells (particularly macrophages) can increase zinc concentrations in phagosomes as an antimicrobial strategy.

  • ZntB-mediated zinc efflux helps bacteria survive this zinc toxicity, potentially enhancing persistence within host cells .

  • The disruption of zntB increases bacterial sensitivity to zinc, which could translate to reduced survival in zinc-rich host environments .

• Adaptation to Varying Zinc Availability:

  • Different host compartments exhibit varying zinc concentrations, from zinc-limited to zinc-rich environments.

  • ZntB helps bacteria maintain optimal intracellular zinc levels despite these fluctuations, supporting growth and virulence in diverse host tissues.

  • This adaptability contributes to Salmonella's success as a pathogen capable of infecting multiple host tissues.

• Regulation of Virulence Factors:

  • Zinc levels influence the expression of various virulence factors in pathogenic bacteria.

  • By maintaining appropriate intracellular zinc concentrations, ZntB may indirectly regulate virulence gene expression.

  • This regulatory role could affect key virulence properties such as adhesion, invasion, and toxin production.

• Contribution to Colonization:

  • Efficient zinc homeostasis provides a competitive advantage during intestinal colonization, where zinc availability can fluctuate.

  • ZntB may support Salmonella's ability to establish infection in the gastrointestinal tract, a critical first step in pathogenesis.

Understanding ZntB's role in pathogenesis could potentially inform new antimicrobial strategies that target bacterial zinc homeostasis. Inhibitors of ZntB might sensitize bacteria to zinc toxicity, enhancing host defense mechanisms or improving the efficacy of conventional antibiotics .

What methods can be used to study ZntB regulation?

Understanding the regulation of ZntB expression and activity requires a multi-faceted approach:

• Promoter Analysis and Transcriptional Regulation:

  • Reporter gene fusions: The zntB promoter can be fused to reporter genes (such as lacZ or gfp) to monitor expression levels under different conditions.

  • Electrophoretic mobility shift assays (EMSA) can identify proteins that bind to the zntB promoter region.

  • ChIP-seq (Chromatin Immunoprecipitation followed by sequencing) can identify transcription factor binding sites in vivo.

  • Bioinformatic analysis of the promoter region can identify potential binding sites for known regulatory proteins.

• Expression Analysis:

  • Quantitative RT-PCR to measure zntB mRNA levels under different conditions (varying zinc concentrations, different growth phases, stress conditions).

  • Northern blotting to assess transcript size and stability.

  • Western blotting with antibodies against ZntB to measure protein levels.

  • Proteomics approaches to identify changes in ZntB abundance under different conditions.

• Post-Transcriptional Regulation:

  • RNA stability assays to determine the half-life of zntB mRNA under different conditions.

  • Identification of small RNAs that might regulate zntB expression using RNA-seq or targeted approaches.

  • Analysis of potential RNA-binding proteins that could influence zntB mRNA translation or stability.

• Post-Translational Regulation:

  • Mass spectrometry to identify potential post-translational modifications of ZntB.

  • Site-directed mutagenesis of potential modification sites to assess their functional importance.

  • Activity assays under conditions that might affect post-translational modifications (oxidative stress, varying pH, etc.).

• Environmental Signals Affecting ZntB:

  • Systematic testing of growth conditions (pH, temperature, oxygen availability, nutrient limitation) for effects on zntB expression.

  • Metal specificity testing to identify which metals induce or repress zntB expression.

  • In vivo expression analysis during infection to identify host factors that influence zntB regulation.

These complementary approaches can reveal the complex regulatory network controlling ZntB expression and activity, providing insights into how bacteria modulate zinc homeostasis in response to environmental changes .

What are the key challenges in studying ZntB transport mechanism?

Researchers face several significant challenges when investigating the ZntB transport mechanism:

• Membrane Protein Structural Analysis:

  • Obtaining high-resolution structural data for membrane proteins like ZntB is technically challenging.

  • The hydrophobic nature of membrane proteins makes them difficult to purify in a functional state suitable for crystallography or cryo-electron microscopy.

  • Structural studies often require specialized detergents or lipid environments that might not perfectly mimic the native membrane environment .

• Measuring Direct Transport Activity:

  • Distinguishing direct ZntB-mediated transport from other zinc transport systems requires careful genetic manipulation to create clean backgrounds .

  • Radioisotope studies with 65Zn2+ provide direct evidence but have practical limitations including safety considerations and specialized equipment requirements .

  • The relatively slow transport rates compared to channels can make kinetic measurements challenging.

• Metal Specificity Determination:

  • ZntB appears to transport zinc and possibly cadmium, but determining the exact specificity profile requires carefully controlled competition experiments .

  • Trace metal contamination in experimental buffers can confound results if not carefully controlled.

  • Distinguishing direct transport from indirect effects requires complementary approaches.

• Reconciling ZntB's Evolutionary Background:

  • ZntB's homology to magnesium transporters (CorA family) but function in zinc transport creates an interesting evolutionary puzzle .

  • Understanding how substrate specificity evolved requires detailed structure-function analysis and comparison with related transporters.

  • This functional divergence complicates predictions based on sequence homology alone.

• Distinguishing Transport Mechanism:

  • Determining whether ZntB functions as a channel, carrier, or another transport mechanism requires sophisticated biophysical approaches.

  • The energy source for transport (whether passive diffusion, proton coupling, or another mechanism) remains to be fully elucidated .

  • Reconstitution in artificial membrane systems with controlled electrochemical gradients is needed to resolve these questions.

Addressing these challenges requires integrating multiple experimental approaches, from molecular genetics to biophysics, to build a comprehensive understanding of ZntB function .

How might ZntB research inform antimicrobial development?

ZntB research holds potential for informing novel antimicrobial development strategies:

• ZntB as a Direct Target:

  • Disruption of zntB increases bacterial sensitivity to zinc and cadmium, suggesting that pharmacological inhibition of ZntB might sensitize bacteria to metal toxicity .

  • Small molecule inhibitors of ZntB could potentially work synergistically with the host's innate immune system, which uses zinc toxicity as an antimicrobial strategy in certain compartments.

  • High-throughput screening could identify compounds that selectively block ZntB transport activity.

• Metal Homeostasis as a Vulnerability:

  • Understanding the complete network of zinc transporters, including ZntB, reveals potential vulnerabilities in bacterial metal homeostasis.

  • Combining inhibitors targeting multiple zinc transport systems might create more effective antimicrobial strategies.

  • The disruption of multiple transporters in transport-deficient strains demonstrates the feasibility of this approach .

• Host-Pathogen Interface Targeting:

  • Zinc competition at the host-pathogen interface represents a critical aspect of infection dynamics.

  • Manipulating this balance by targeting ZntB could potentially enhance host defense mechanisms.

  • Understanding how ZntB contributes to pathogenesis in different host environments can identify context-specific intervention strategies.

• Structural Insights for Drug Design:

  • Detailed structural information about ZntB's transport mechanism could inform structure-based drug design.

  • Identifying unique structural features of bacterial ZntB not shared with host zinc transporters would be crucial for developing selective inhibitors.

  • The pentameric nature of ZntB potentially offers multiple binding sites for inhibitory compounds.

• Diagnostic Applications:

  • Knowledge of zntB gene sequences across bacterial species could contribute to molecular diagnostic tools.

  • Understanding zinc homeostasis mechanisms might help in developing diagnostic tests for antimicrobial susceptibility.

The intersection of ZntB research with antimicrobial development represents an opportunity to exploit bacterial metal homeostasis as a therapeutic vulnerability, potentially addressing the critical need for new antimicrobial strategies in the face of rising resistance .