Recombinant Salmonella schwarzengrund 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Biological Role and Enzymatic Function

UbiA belongs to the prenyltransferase family, catalyzing the Mg²⁺-dependent transfer of a polyprenyl chain from isoprenyl diphosphate to 4-hydroxybenzoate (4HB) (Figure 1A) . This reaction produces 3-polyprenyl-4-hydroxybenzoate, a precursor for ubiquinone biosynthesis. Key features include:

  • Conserved motifs: Two aspartate-rich motifs (NDXXDXXXD and DXXXD) critical for Mg²⁺ coordination and substrate binding .

  • Membrane topology: Nine transmembrane helices with cytoplasmic loops containing catalytic domains .

Structural studies of UbiA homologs (e.g., AfUbiA from Archaeoglobus fulgidus) reveal a pseudosymmetric four-helix bundle architecture, with active-site residues (N68, D72, D198, D202, Y139) essential for catalysis .

Active-Site Architecture

  • Mg²⁺ binding: Two Mg²⁺ ions coordinated by residues in aspartate-rich motifs (N68, D72, D198, D202).

  • Substrate interaction: The diphosphate group of isoprenyl substrates binds to Mg²⁺ and basic residues (R22, K146).

  • Catalytic residues: Y139 and S140 position the phenolic oxygen of 4HB for nucleophilic attack on the prenyl diphosphate.

Mutational Analysis

Functional assays on E. coli MenA (a UbiA homolog) demonstrated:

  • N68A/D72A mutations: Complete loss of enzymatic activity.

  • D198A/D202A mutations: >90% reduction in prenyltransferase activity.

  • Y139F mutation: Disrupted substrate positioning, abolishing catalysis .

Applications in Research

Recombinant UbiA is utilized in:

  1. Enzyme kinetics: Studying Mg²⁺-dependent prenyltransferase mechanisms .

  2. Antimicrobial studies: Investigating links between ubiquinone biosynthesis and bacterial virulence .

  3. Structural biology: Cryo-EM and crystallography to resolve membrane-protein interactions .

Associated Virulence and Resistance

While UbiA itself is not a virulence factor, S. schwarzengrund strains carrying IncFIB-IncFIC(FII) plasmids (common in poultry-associated isolates) exhibit:

  • Streptomycin resistance: Mediated by plasmid-borne aadA genes .

  • Iron acquisition: Plasmid-encoded aerobactin operon (iucA/iutA) enhances survival in low-iron environments .

Notably, these plasmids do not enhance invasion in human Caco-2 cells but may contribute to extraintestinal persistence .

Future Directions

  • Mechanistic studies: Elucidating the role of pseudosymmetric helices in substrate binding .

  • Therapeutic targeting: Developing inhibitors against UbiA to disrupt bacterial electron transport .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know and we will prioritize developing the specified tag.
Synonyms
ubiA; SeSA_A4426; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
ubiA
Target Protein Sequence
MEWSLTQSKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGMPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVLTLNAMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGLGWGYY WAVLVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. This enzyme mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of 4-hydroxybenzoate octaprenyltransferase (ubiA) in Salmonella schwarzengrund?

4-hydroxybenzoate octaprenyltransferase (ubiA) catalyzes a critical step in ubiquinone biosynthesis by attaching an octaprenyl diphosphate to 4-hydroxybenzoate. The enzyme is classified with EC number 2.5.1.- and is also known as 4-HB polyprenyltransferase . This membrane-bound enzyme enables the prenylation reaction necessary for subsequent modifications that lead to functional ubiquinone, an essential component of the electron transport chain in bacterial systems. In the biosynthetic pathway, 4-hydroxybenzoate is formed and then attached to membrane-bound octaprenyl diphosphate by this membrane-bound octaprenyltransferase . This represents a critical junction in the pathway linking aromatic precursors to lipid-soluble electron carriers.

How is the ubiA gene organized in the Salmonella schwarzengrund genome?

The ubiA gene in Salmonella schwarzengrund is identified by the ordered locus name SeSA_A4426 . Like many genes involved in basic metabolic functions, ubiA exists within an operon structure that coordinates the expression of multiple genes involved in ubiquinone biosynthesis. Genomic context analysis reveals that ubiA is part of the core genome of Salmonella species, reflecting its essential role in energy metabolism. The gene's chromosomal location and organization provide insights into the regulation of ubiquinone biosynthesis in relation to other metabolic pathways in Salmonella.

How does T3SS activation influence ubiA expression and ubiquinone biosynthesis?

Recent research has uncovered interesting links between Type 3 Secretion System (T3SS) activation and lipid metabolism in enteropathogenic bacteria. Upon T3SS activation, a comprehensive remodeling of bacterial lipid metabolism occurs, particularly affecting quinone biosynthesis pathways. Studies have shown that T3SS activation results in a shift from menaquinones and ubiquinones to undecaprenyl lipids . This metabolic shift suggests that ubiA's activity may be downregulated during host infection, potentially through transcriptional regulation or post-translational modifications. The regulatory connection between virulence factor expression and primary metabolism represents an important area for further investigation, as it may reveal new targets for antimicrobial development.

What are the structure-function relationships in ubiA that determine substrate specificity?

Structure-function analysis of ubiA reveals several domains critical for its enzymatic activity. The protein contains multiple transmembrane domains with conserved motifs that form the active site within the membrane bilayer. Key residues that coordinate substrate binding include:

DomainResiduesFunction
Transmembrane helix 1-220-80Membrane anchoring and creating hydrophobic substrate channel
Central loop region110-140Coordination of prenyl substrate
C-terminal domain250-2904-hydroxybenzoate binding site

Conserved aspartate and tyrosine residues in the active site are thought to participate in catalysis based on homology with other prenyltransferases . The "DDXD" motif found in many prenyltransferases is implicated in coordinating the divalent metal ions (typically Mg²⁺) required for catalysis. Site-directed mutagenesis studies of similar enzymes have demonstrated that altering these conserved residues dramatically reduces catalytic efficiency.

How does membrane composition affect ubiA activity and ubiquinone biosynthesis?

As a membrane-integral enzyme, ubiA's activity is highly dependent on the lipid environment. Changes in membrane composition can significantly alter enzyme kinetics and substrate accessibility. Research on related systems has shown that:

  • Membrane fluidity affects the lateral mobility of ubiA and its ability to access substrates

  • Phospholipid headgroup composition influences the proper folding and orientation of ubiA in the membrane

  • Membrane potential may regulate substrate binding and product release

These factors become particularly relevant during bacterial stress responses and host infection, where membrane composition undergoes dramatic changes. For instance, the shift from phospholipids towards lysophospholipids observed during T3SS activation likely impacts ubiA positioning and activity. Additionally, increased O-antigen levels and changes in cell surface charge may further modulate membrane-associated enzymatic processes including ubiquinone biosynthesis.

What are the optimal conditions for expression and purification of recombinant ubiA?

Successful expression and purification of functional recombinant ubiA requires careful optimization of conditions to maintain its native conformation and activity. Based on current protocols:

Expression system:

  • E. coli is the preferred heterologous expression system

  • Codon-optimized constructs improve expression levels

  • Expression vectors with tightly regulated promoters (e.g., T7) minimize toxicity

  • Lower induction temperatures (16-20°C) improve proper folding

Purification strategy:

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents (DDM, LDAO, or CHAPS)

  • Metal affinity chromatography utilizing the His-tag

  • Size exclusion chromatography for final purification

The purified protein should be maintained in a buffer containing:

  • Tris or phosphate buffer (pH 7.5-8.0)

  • 150-300 mM NaCl

  • 0.02-0.05% detergent

  • 10-20% glycerol for stability

For storage, aliquoting and storage at -80°C is recommended, with avoidance of repeated freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week .

How can enzymatic activity of recombinant ubiA be measured in vitro?

Assessing the enzymatic activity of recombinant ubiA requires specialized techniques due to its membrane association and hydrophobic substrates. Standard activity assays include:

Radiometric assay:

  • Using ¹⁴C-labeled 4-hydroxybenzoate

  • Incubation with prenyl donor (octaprenyl diphosphate)

  • Extraction of products with organic solvent

  • Quantification via liquid scintillation counting

HPLC-based assay:

  • Reaction of substrates with purified enzyme

  • Extraction of prenylated products

  • Separation by reverse-phase HPLC

  • Detection by UV absorbance or fluorescence

Coupled enzyme assay:

  • Monitoring pyrophosphate release using pyrophosphatase

  • Quantifying released phosphate with colorimetric methods

For optimal activity, the reaction mixture should include:

  • 50-100 mM Tris or HEPES buffer (pH 7.5)

  • 5-10 mM MgCl₂

  • 0.1-1% suitable detergent

  • 4-hydroxybenzoate (50-200 μM)

  • Octaprenyl diphosphate (10-50 μM)

  • Purified enzyme (1-5 μg)

These assays permit determination of kinetic parameters (Kₘ, Vₘₐₓ, kcat) essential for understanding the enzyme's catalytic efficiency and substrate preferences.

What approaches are effective for studying ubiA's membrane topology and integration?

Understanding the membrane topology of ubiA is crucial for elucidating its mechanism. Several complementary approaches can be employed:

Computational prediction:

  • Hydrophobicity analysis using algorithms like TMHMM and Phobius

  • Comparison with homologous proteins of known structure

Experimental validation:

  • Cysteine scanning mutagenesis:

    • Introduction of cysteine residues at various positions

    • Selective labeling of exposed cysteines

    • Determination of membrane-protected regions

  • Fusion protein approach:

    • Creation of fusions with reporter proteins (GFP, alkaline phosphatase)

    • Analysis of reporter activity to determine topology

  • Limited proteolysis:

    • Treatment of membrane-embedded enzyme with proteases

    • Identification of protected fragments by mass spectrometry

    • Mapping of membrane-spanning regions

  • Fluorescence spectroscopy:

    • Introduction of environmentally sensitive fluorophores

    • Monitoring fluorescence changes in different membrane environments

These approaches, when combined, provide a comprehensive view of ubiA's membrane integration pattern, helping researchers understand how the enzyme accesses its substrates and releases products across the membrane barrier.

How does ubiA function contribute to Salmonella pathogenesis and stress responses?

The function of ubiA in ubiquinone biosynthesis directly impacts Salmonella's pathogenicity through several mechanisms:

  • Energy metabolism during infection:

    • Ubiquinone is essential for aerobic respiration

    • Facilitates adaptation to changing oxygen availability in host tissues

    • Supports ATP generation needed for virulence factor expression

  • Oxidative stress resistance:

    • Ubiquinone acts as an antioxidant in bacterial membranes

    • Helps neutralize host-generated reactive oxygen species

    • Protects bacterial DNA and proteins from oxidative damage

  • Membrane remodeling during host interaction:

    • T3SS activation leads to shifts in quinone metabolism

    • Changes in membrane composition affect bacterial surface properties

    • Altered O-antigen levels and cell surface charge influence host interactions

The connections between T3SS activation, CsrA repression, and lipid metabolism remodeling suggest sophisticated regulatory networks linking virulence and metabolism . The shift from phospholipids towards lysophospholipids and from menaquinones/ubiquinones to undecaprenyl lipids represents a coordinated response to host conditions that may enhance bacterial survival and colonization.

What potential exists for targeting ubiA for antimicrobial development?

UbiA presents an attractive target for novel antimicrobial development for several reasons:

  • Essential metabolic function:

    • Ubiquinone is required for aerobic respiration

    • No alternate pathway exists in most bacteria

    • Inhibition would severely compromise bacterial energy metabolism

  • Structural differences from human homologs:

    • Bacterial ubiA differs sufficiently from human counterparts

    • Allows for selective targeting with reduced host toxicity

    • Structure-based drug design can exploit these differences

  • Known inhibitory compounds:

    • Several prenyl transferase inhibitors show antimicrobial activity

    • Structure-activity relationships can guide optimization

    • Both competitive and non-competitive inhibition strategies are viable

Potential development strategies include:

  • High-throughput screening against purified recombinant ubiA

  • Rational design based on substrate analogs

  • Fragment-based approaches targeting the active site

  • Allosteric inhibitors disrupting protein dynamics

The connection between ubiquinone biosynthesis and virulence factor expression suggests that ubiA inhibitors might not only kill bacteria directly but could also attenuate pathogenicity, representing a dual-action antimicrobial strategy.

How can recombinant ubiA be used to study membrane protein biogenesis and folding?

Recombinant ubiA serves as an excellent model system for studying membrane protein biogenesis due to:

  • Moderate size and complexity:

    • 290 amino acids with multiple transmembrane domains

    • Representative of many bacterial membrane proteins

    • Manageable for in vitro studies

  • Functional assayability:

    • Enzymatic activity provides direct measure of proper folding

    • Allows quantitative assessment of folding efficiency

    • Permits correlation between structure and function

Research applications include:

  • Investigating chaperone requirements for membrane protein folding

  • Determining lipid requirements for proper insertion and function

  • Studying the effects of mutations on membrane integration

  • Testing the impact of post-translational modifications on stability

Experimental approaches might include:

  • In vitro translation-translocation systems

  • Reconstitution into proteoliposomes of defined composition

  • Single-molecule fluorescence to monitor folding trajectories

  • Hydrogen-deuterium exchange mass spectrometry to probe dynamics

Such studies contribute not only to understanding ubiA specifically but also to broader principles of membrane protein biogenesis applicable across biological systems.

What are the current limitations in ubiA research and potential solutions?

Despite significant progress, several challenges remain in ubiA research:

  • Structural characterization:

    • High-resolution structures of bacterial ubiA are lacking

    • Membrane protein crystallization remains technically challenging

    • Cryo-EM approaches offer promising alternatives

  • Dynamic interactions:

    • Interactions with other components of ubiquinone biosynthesis pathway are poorly understood

    • Potential protein complexes have not been fully characterized

    • Advanced proteomics and imaging approaches needed

  • In vivo regulation:

    • Mechanisms controlling ubiA expression and activity during infection remain unclear

    • Integration with virulence regulation networks needs further exploration

    • Systems biology approaches could address these knowledge gaps

Future research should focus on developing improved methods for membrane protein purification and crystallization, as well as applying advanced techniques like hydrogen-deuterium exchange mass spectrometry and single-particle cryo-EM to elucidate ubiA's structure and dynamics. Additionally, comprehensive proteomic and transcriptomic analyses during infection could reveal key regulatory mechanisms connecting ubiquinone metabolism to virulence.

How might synthetic biology approaches enhance ubiA research?

Synthetic biology offers novel approaches to overcome current limitations:

  • Engineered expression systems:

    • Designer cell-free systems for membrane protein production

    • Genetic code expansion for site-specific incorporation of probes

    • Minimized genomes for reduced interference from host processes

  • Protein engineering:

    • Creation of soluble variants while maintaining activity

    • Introduction of biophysical probes at critical positions

    • Development of split-protein reporters for interaction studies

  • Pathway reconstitution:

    • In vitro reconstruction of complete ubiquinone biosynthesis

    • Cell-free systems for high-throughput inhibitor screening

    • Modular assembly of pathway components for optimization

These approaches not only advance our understanding of ubiA but also provide templates for studying other challenging membrane proteins, potentially leading to breakthroughs in antimicrobial development and synthetic metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.