Recombinant Salmonella schwarzengrund ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Pathogenesis

The atpF subunit is integral to the F₀ sector of the ATP synthase, which facilitates proton translocation across the bacterial membrane. Research highlights its interaction with virulence factors:

  • MgtC-Mediated Inhibition: MgtC, a Salmonella virulence protein, inhibits the F₁F₀ ATP synthase by binding to the a subunit (F₀ sector), disrupting proton translocation and ATP synthesis. This interaction maintains physiological ATP levels and cytoplasmic pH, enhancing bacterial survival within host macrophages .

  • Pathogenicity Link: Mutations in MgtC that impair ATP synthase inhibition reduce Salmonella virulence, underscoring atpF’s indirect role in pathogenicity .

**3.1 Biochemical Assays

Recombinant atpF is primarily used in:

  • SDS-PAGE: To confirm protein purity and structural integrity .

  • Enzymatic Studies: Investigating ATP synthase activity and its regulation by proteins like MgtC .

**3.2 Disease Modeling

The protein serves as a tool to study Salmonella’s strategies to counteract host defenses, particularly in understanding how ATP synthase modulation contributes to intracellular survival .

Research Gaps and Future Directions

While recombinant atpF has clarified its role in ATP synthase function, further studies are needed to:

  1. Elucidate Subunit Interactions: Determine if atpF directly interacts with MgtC or other virulence factors.

  2. Explore Host-Pathogen Dynamics: Investigate how ATP synthase modulation impacts Salmonella’s ability to evade host immune responses.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; SeSA_A4079; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous F1 catalytic core and the membrane-embedded F0 proton channel, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This subunit is a component of the F0 channel and part of the peripheral stalk, linking F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the atpF gene in Salmonella and what role does it play in ATP synthase?

The atpF gene encodes the b subunit of ATP synthase, a critical component of the F₀ sector in this molecular machine. ATP synthase uses a unique rotational mechanism to convert chemical energy into mechanical energy and vice versa. The b subunit serves as part of the peripheral stalk (stator) in ATP synthase, which prevents rotation of the F₁ domain during catalysis . In bacterial ATP synthases like that of Salmonella, subunit b exists as a dimer, with residues 62-122 particularly important for mediating this dimerization . The peripheral stalk formed partly by subunit b is crucial for stabilizing the c-ring/F₁ complex and maintaining the structural integrity needed for ATP synthesis to occur .

What is the structure of Salmonella ATP synthase subunit b?

The b subunit of Salmonella ATP synthase forms an extremely elongated structure consisting primarily of α-helical elements. Analytical ultracentrifugation and solution small-angle X-ray scattering (SAXS) studies indicate that the b(62-122) dimer has a frictional ratio of 1.60, a maximal dimension of 95 Å, and a radius of gyration of 27 Å, consistent with an alpha-helical coiled-coil structure . Crystal structure analysis at 1.55 Å resolution has shown that the protein can crystallize as an isolated, monomeric alpha helix with a length of approximately 90 Å .

In bacterial ATP synthases, the N-terminal region of subunit b contains a single membrane-embedded α-helix that forms important interactions with subunit a. Notably, in the assembled complex, the two copies of subunit b make different interactions with subunit a - one interacts with transmembrane α-helices 1, 2, 3, and 4, while the other interacts with α-helices 5 and 6 and the loop between α-helices 3 and 4 .

How does the b subunit contribute to the rotational mechanics of ATP synthase?

The b subunit plays several critical roles in ATP synthase function:

  • As part of the peripheral stalk (b₂δ), it prevents rotation of the α₃β₃ hexamer during catalysis while allowing the γ subunit to rotate within it .

  • The C-terminal water-soluble part of subunit b displays significant conformational variability between rotational states, suggesting it contributes to the transient storage of torsional energy during rotation .

  • The b subunit's elongated structure allows it to span from the membrane to the top of the F₁ sector, accommodating the substantial distance while remaining flexible enough to adapt to different rotational states .

Cryo-EM studies have revealed that the peripheral stalk in bacteria is structurally simpler and more flexible than in yeast mitochondria, suggesting that bacterial subunits a and the c-ring are mainly held together by hydrophobic interactions rather than by the peripheral stalk .

What expression systems are most suitable for producing functional recombinant Salmonella atpF?

Several expression systems can be used for recombinant Salmonella atpF production, each with specific advantages:

Expression SystemAdvantagesDisadvantagesBest Applications
E. coli BL21(DE3)High yield, simple culture conditionsPotential inclusion body formationBasic structural studies
E. coli DK8 strainLacks endogenous ATP synthaseMore specialized strainFunctional studies
Yeast systemsBetter protein foldingLower yieldStudies requiring eukaryotic-like modifications
Baculovirus/insect cellsExcellent for complex proteinsExpensive, technically demandingDetailed structural studies

For most applications, E. coli remains the system of choice due to its simplicity and cost-effectiveness . Specifically, the DK8 strain (which lacks endogenous ATP synthase) has been successfully used for expressing ATP synthase components from various bacteria .

What is the optimal purification protocol for obtaining high-purity recombinant atpF?

A comprehensive purification protocol for high-purity recombinant atpF would include:

  • Cell lysis: Using French Press in buffer containing protease inhibitors .

  • Membrane preparation: Differential centrifugation at 35,000 rpm for 30 minutes to remove cell debris .

  • Affinity chromatography: Application to Ni²⁺-NTA column equilibrated with 20 mM imidazole and 100 mM NaCl (pH 7.0), washing with 50 mM imidazole, and elution with 500 mM imidazole .

  • Size exclusion chromatography: Further purification using Superdex 200 column to separate monomeric, dimeric, and aggregated forms.

  • Storage: Either as precipitate in 70% saturated ammonium sulfate at 4°C or in buffer containing glycerol at -80°C .

This protocol typically yields protein of >95% purity suitable for crystallography, cryo-EM, or other high-resolution structural techniques.

What are common challenges in expressing and purifying functional recombinant atpF?

Researchers commonly encounter several challenges when working with atpF:

ChallengePossible CausesSolutions
Poor expressionToxicity, codon biasUse tightly regulated expression systems, optimize codons
Inclusion body formationRapid expression, improper foldingLower induction temperature (16-20°C), reduce inducer concentration
Membrane integration issuesOverloading membrane machineryUse specialized strains (C41/C43), include proper signal sequences
Aggregation during purificationHydrophobic interactionsScreen detergents (DDM, digitonin), include glycerol
Low yield of dimeric formDisruption of dimer interfaceAvoid harsh purification conditions, use chemical cross-linking

A systematic troubleshooting approach involves sequential optimization of expression temperature, induction conditions, lysis methods, and purification buffers . When working with the transmembrane domain, screening different detergents is critical.

What mutations in atpF affect ATP synthase assembly and function?

Mutations in atpF have provided valuable insights into structure-function relationships in ATP synthase:

Mutation RegionEffect on AssemblyEffect on FunctionMechanistic Insight
N-terminal membrane domainSevere impairmentLoss of activityCritical for interaction with subunit a
Dimerization domain (residues 62-122)Disruption of dimer formationReduced ATP synthesisEssential for peripheral stalk stability
C-terminal domainVariable assembly defectsReduced coupling efficiencyImportant for interactions with F₁ sector

Particularly informative mutations include those in the N-terminal transmembrane helix that disrupt interactions with subunit a, preventing proper assembly of the F₀ sector. This region is critical as the two copies of subunit b make different interactions with subunit a in the assembled complex .

How can researchers verify the structural integrity and functionality of purified recombinant atpF?

Verification of recombinant atpF should include both structural and functional assessments:

Structural integrity validation:

  • Circular dichroism (CD) spectroscopy to confirm α-helical content

  • Size exclusion chromatography to determine oligomeric state

  • Thermal shift assays to assess protein stability

  • Limited proteolysis to evaluate domain structure

Functional validation:

  • Complementation assays in atpF-deficient bacterial strains

  • Reconstitution studies with other ATP synthase components

  • ATP synthesis/hydrolysis assays when incorporated into ATP synthase complex

  • Proton-pumping assays using pH-sensitive fluorescent dyes

  • Binding assays with known partner subunits (e.g., subunit a, δ)

The combination of these approaches provides comprehensive validation of recombinant atpF and ensures that any subsequent experimental findings are based on properly folded and functional protein.

What advanced biophysical techniques can be applied to study atpF dynamics in ATP synthase?

Several advanced biophysical techniques can provide insights into atpF dynamics:

  • Single-molecule FRET: By labeling specific residues in atpF and interacting subunits with donor-acceptor fluorophore pairs, conformational changes during rotation can be monitored in real-time with nanometer precision .

  • High-speed atomic force microscopy (HS-AFM): This allows visualization of structural changes in the peripheral stalk during ATP hydrolysis or synthesis.

  • Time-resolved cryo-EM: By rapidly freezing samples at different stages of the catalytic cycle, structural intermediates can be captured and reconstructed .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of atpF that undergo conformational changes or exhibit different solvent accessibility during the catalytic cycle.

  • Site-directed spin labeling with electron paramagnetic resonance (EPR): This approach can measure distances between specific sites and detect conformational changes with high precision.

What critical considerations are important when designing expression vectors for recombinant Salmonella atpF?

When designing expression vectors for atpF, researchers should consider:

  • Promoter selection:

    • T7 promoter systems offer high-level expression but may lead to inclusion bodies

    • Weaker promoters like araBAD provide more controlled expression

    • Inducible systems allow toxicity management

  • Tag placement:

    • N-terminal tags are preferred as C-terminal regions interact with other subunits

    • Multiple tag options: His₆ for purification, fluorescent proteins for localization studies

    • Inclusion of protease cleavage sites to remove tags when necessary

  • Truncation strategy:

    • Full-length constructs for functional studies

    • Transmembrane domain deletion for soluble expression

    • Dimerization domain isolation (residues 62-122) for structural studies

  • Multisubunit expression:

    • Co-expression with partner subunits may improve folding

    • Polycistronic constructs can ensure stoichiometric expression

Example vector designs that have proven successful include pET-based vectors with N-terminal His₁₀ tags for high-yield purification .

How can protein engineering approaches be applied to study specific aspects of atpF function?

Protein engineering approaches can provide valuable insights into atpF function:

  • Deletion analysis:

    • Systematic deletion of specific regions can identify elements critical for dimerization or interaction with other subunits

    • Similar to studies on the β subunit loop, where deletions of 7, 10, and 14 residues revealed the critical length required for function

  • Site-directed mutagenesis:

    • Alanine scanning of interface residues to identify key interaction points

    • Introduction of cysteine pairs for disulfide cross-linking to stabilize specific conformations

    • Charge reversal mutations to disrupt electrostatic interactions

  • Domain swapping:

    • Replacing segments of atpF with corresponding regions from other species can identify species-specific functional elements

    • Chimeric constructs between related ATP synthase b subunits can map functional domains

  • Fusion protein approaches:

    • Reporter protein fusions can track localization and assembly

    • Split-protein complementation assays can monitor protein-protein interactions in vivo

    • FRET pair insertions at specific sites can report on conformational changes

These approaches have been successfully applied to other ATP synthase subunits and could be adapted for atpF studies .

How can recombinant atpF be utilized in studying antimicrobial resistance in Salmonella Schwarzengrund?

AtpF can serve as a valuable tool for investigating antimicrobial resistance:

  • Energy metabolism connections:

    • ATP synthase provides energy for efflux pumps and other resistance mechanisms

    • Mutations affecting energy production can impact susceptibility to antimicrobials

    • Modified energy metabolism is a known adaptation in resistant strains

  • Experimental approaches:

    • Conditional expression systems can help identify energy requirements for resistance mechanism function

    • Metabolic flux analysis using atpF mutants can reveal adaptations in resistant strains

    • Comparative studies between susceptible and resistant isolates may reveal differences in ATP synthase function

Recent studies have shown that antimicrobial resistance genes are common among Salmonella Schwarzengrund isolates, with 61.7% carrying at least one AMR gene . The most commonly observed resistance genes include aph(3'')-Ib (aminoglycoside; 47.1%), tet(A) (tetracycline; 9.2%) and sul2 (sulfonamide; 7.3%) . The energy demands of expressing these resistance mechanisms may create selective pressure for adaptations in ATP synthase function.

What role does atpF play in Salmonella pathogenesis that could inform therapeutic strategies?

AtpF contributes to Salmonella pathogenesis through several mechanisms:

  • Energy provision for virulence factor expression:

    • ATP synthase supplies energy needed for transcription of virulence genes

    • Proper function of secretion systems (T1SS, T3SS) requires ATP

    • Motility and chemotaxis are energy-intensive processes critical for infection

  • Adaptation to host environments:

    • Intracellular Salmonella must adjust energy metabolism to nutrient-limited conditions

    • ATP synthase activity may be regulated differently in host cells

    • Proton gradient maintenance is essential for survival in acidic phagosomes

  • Therapeutic implications:

    • Targeting ATP synthase could compromise bacterial survival

    • AtpF-specific inhibitors might be developed as narrow-spectrum antimicrobials

    • Modified atpF could create attenuated strains for vaccine development

Understanding the regulation of atpF expression during infection is particularly relevant for developing interventions. Secretion systems essential for Salmonella virulence depend on the energy provided by ATP synthase, suggesting that atpF indirectly contributes to pathogenesis .

What are the potential applications of recombinant Salmonella atpF in vaccine development?

Recombinant Salmonella atpF has several potential applications in vaccine research:

  • Component of subunit vaccines:

    • AtpF can be used as a carrier protein for antigenic peptides

    • Its dimeric nature can present multiple epitopes

    • Stability and immunogenicity may be advantages for vaccine formulation

  • Design of attenuated live vaccines:

    • Modified atpF can create strains with regulated attenuation

    • Energy production limitations can restrict in vivo growth while maintaining immunogenicity

    • Can be combined with other attenuating mutations for optimal safety and efficacy

  • Diagnostic applications:

    • Antibodies against atpF can serve as markers of Salmonella infection

    • Strain-specific variations in atpF can be exploited for serotyping

Research in recombinant attenuated Salmonella vaccines has demonstrated that regulating key genes involved in metabolism can create vaccines that efficiently colonize lymphoid tissues without causing disease symptoms, resulting in long-lasting protective immune responses .

How might structural differences in atpF across Salmonella serovars impact virulence and host specificity?

Comparative analysis of atpF across Salmonella serovars may reveal important structural adaptations related to host range and virulence. While the core function of ATP synthase is conserved, subtle variations in the sequence and structure of atpF could affect:

  • Protein-protein interactions within the ATP synthase complex

  • Energy production efficiency under different environmental conditions

  • Stability of the complex in various host-associated environments

  • Immunogenicity and recognition by host immune systems

Systematic comparison of atpF sequences from host-restricted serovars (like S. Typhi) versus broad-host-range serovars (like S. Typhimurium) could identify key residues associated with host adaptation . Such studies would benefit from combining structural biology approaches with functional assays and in vivo infection models.

What innovative approaches could enhance the expression and purification of challenging atpF constructs?

For particularly challenging atpF constructs, several innovative approaches could be explored:

  • Cell-free protein synthesis systems:

    • Avoid toxicity issues associated with overexpression

    • Allow direct incorporation of non-canonical amino acids for biophysical studies

    • Enable rapid screening of different detergents and buffer conditions

  • Novel fusion partners:

    • Engineered highly soluble proteins as N-terminal fusion partners

    • Nanobodies or designed ankyrin repeat proteins (DARPins) that bind specific conformations

    • Split-inteins for purification of otherwise insoluble constructs

  • Directed evolution strategies:

    • Creating libraries of atpF variants and selecting for improved expression

    • Using CRISPR/Cas9 systems to enhance protein yield and quality

    • High-throughput screening approaches to identify optimal conditions

  • Alternative host systems:

    • Extremophiles for expression of thermostable variants

    • Cell lines derived from natural Salmonella hosts

    • Synthetic minimal cells with customized expression machinery

These approaches could help overcome the economic, efficiency, and environmental challenges that currently limit the industrial-scale production of recombinant proteins for research and therapeutic applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.