Recombinant Salmonella schwarzengrund Electron transport complex protein RnfE (rnfE)

What is the RnfE protein in Salmonella schwarzengrund?

RnfE is an electron transport complex protein in Salmonella schwarzengrund that functions as part of the Rnf complex (Rhodobacter nitrogen fixation), which is involved in electron transfer processes. The protein is encoded by the rnfE gene and is characterized by transmembrane domains that facilitate its function in the bacterial membrane. The full-length RnfE protein consists of 230 amino acids with a predicted molecular structure that includes multiple transmembrane domains critical for its function in electron transport .

The amino acid sequence reveals that RnfE contains several hydrophobic regions typical of membrane proteins, with alternating hydrophobic and hydrophilic segments that form transmembrane helices. These structural features enable RnfE to participate in electron transfer across the bacterial membrane, contributing to energy metabolism in Salmonella schwarzengrund .

What genomic characteristics define Salmonella schwarzengrund compared to other Salmonella serovars?

Salmonella schwarzengrund exhibits distinct genomic features that differentiate it from other Salmonella serovars. Comparative genomic analysis has revealed that S. schwarzengrund contains a core genome of approximately 3374 genes shared across strains, along with an accessory genome of around 2906 genes and strain-specific unique genes (approximately 835) .

The genomic analysis of S. schwarzengrund strain S16, for example, identified 81 unique genes including hypothetical proteins and transcriptional regulators. These unique genomic elements may contribute to the specific ecological niches and pathogenicity of this serovar. Multilocus sequence typing (MLST) has identified S. schwarzengrund strain S16 as sequence type ST96, which is frequently associated with poultry and environmental sources .

How does the RnfE protein contribute to bacterial energy metabolism?

The RnfE protein forms part of the Rnf complex, which functions as an ion-translocating ferredoxin:NAD+ oxidoreductase in many bacteria. This complex couples the transfer of electrons with the generation of a transmembrane ion gradient that can be used for energy conservation. The methodological approach to study this function involves:

• Membrane fraction isolation: Separating bacterial membranes containing the Rnf complex

• Electron transport assays: Measuring electron transfer rates using artificial electron donors and acceptors

• Membrane potential measurements: Assessing the contribution of RnfE to transmembrane potential generation

The amino acid sequence of RnfE shows multiple transmembrane segments that anchor the protein within the cell membrane, positioning it optimally for electron transport functions. The sequence "MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYV..." reveals hydrophobic domains critical for membrane insertion and function .

What experimental approaches are most effective for studying RnfE function in Salmonella schwarzengrund?

The study of RnfE function in Salmonella schwarzengrund requires a multi-faceted experimental approach:

• Gene knockout and complementation studies:

  • Generate rnfE deletion mutants using homologous recombination techniques

  • Complement with wild-type or mutated rnfE genes to verify phenotypic changes

  • Assess effects on bacterial growth, metabolism, and virulence

• Protein-protein interaction studies:

  • Utilize pulldown assays coupled with mass spectrometry, similar to methods used for YqiC protein

  • Perform bacterial two-hybrid assays to identify interaction partners

  • Use chemical crosslinking followed by size exclusion chromatography to determine oligomeric states

• Electron transport chain analysis:

  • Measure NADH dehydrogenase activity in wild-type versus rnfE mutants

  • Assess membrane potential using fluorescent probes

  • Determine oxygen consumption rates using respirometry

• Structural studies:

  • Express and purify recombinant RnfE protein

  • Perform X-ray crystallography or cryo-EM to determine three-dimensional structure

  • Use site-directed mutagenesis to identify critical functional residues

Similar methodologies have been successfully applied to study YqiC, another protein involved in Salmonella's electron transport chain, revealing interactions with Complex II subunits (SdhA and SdhB) and the β-subunit of F0F1-ATP synthase .

How does RnfE expression correlate with antibiotic resistance in Salmonella schwarzengrund?

The correlation between RnfE expression and antibiotic resistance in Salmonella schwarzengrund can be investigated through several methodological approaches:

• Transcriptomic analysis:

  • Compare rnfE expression levels between antibiotic-resistant and susceptible strains using RNA-seq

  • Determine if antibiotic exposure alters rnfE expression patterns

  • Identify co-expressed genes that might contribute to resistance mechanisms

• Antibiotic susceptibility testing:

  • Perform minimum inhibitory concentration (MIC) assays comparing wild-type and rnfE mutants

  • Test against multiple antibiotic classes to identify specific resistance patterns

  • Evaluate synergistic effects of electron transport chain inhibitors with antibiotics

• Efflux pump activity assays:

  • Measure accumulation of fluorescent substrates in wild-type versus rnfE mutants

  • Determine if RnfE contributes to proton motive force necessary for efflux pump function

  • Assess expression of efflux pump genes in response to rnfE deletion

Genomic analysis of S. schwarzengrund strains has identified various antibiotic resistance genes. For instance, strain S16 exhibits resistance to several antibiotics including amikacin, ciprofloxacin, sulfamethoxazole, streptomycin, and tetracycline . The strain carries multiple resistance genes and uniquely harbors a mutation in gyrB, distinguishing it from other S. schwarzengrund genomes. All analyzed S. schwarzengrund genomes carry at least one antibiotic resistance gene, with the aac(6′)-Iaa gene (conferring aminoglycoside resistance) being universally present .

What protein-protein interactions are critical for RnfE function in the electron transport chain?

The functionality of RnfE within the electron transport chain depends on specific protein-protein interactions that can be methodically investigated:

• Co-immunoprecipitation coupled with mass spectrometry:

  • Express tagged RnfE in Salmonella schwarzengrund

  • Perform co-IP followed by mass spectrometry to identify interaction partners

  • Validate interactions using reverse co-IP experiments

• Bacterial two-hybrid system analysis:

  • Screen for potential interaction partners using RnfE as bait

  • Quantify interaction strength through reporter gene expression

  • Map interaction domains through truncation mutants

• Proximity labeling techniques:

  • Utilize BioID or APEX2 proximity labeling fused to RnfE

  • Identify proteins in close proximity to RnfE under various growth conditions

  • Compare interactome differences between normal and stress conditions

Similar approaches applied to YqiC, another protein involved in Salmonella's electron transport chain, revealed interactions with subunits of Complex II (SdhA and SdhB) and the β-subunit of F0F1-ATP synthase . These interactions suggest a potential role in modulating energy production, which could subsequently affect the assembly of virulence factors like flagella.

The interaction network of electron transport proteins in Salmonella can be visualized as follows:

How do genomic analysis techniques help characterize the evolutionary significance of RnfE?

Genomic analysis provides crucial insights into the evolutionary significance of RnfE in Salmonella schwarzengrund:

• Comparative genomics methodology:

  • Align rnfE sequences from diverse Salmonella serovars and related enterobacteria

  • Calculate sequence conservation, selection pressure (dN/dS ratios)

  • Identify conserved domains versus variable regions

  • Construct phylogenetic trees to trace evolutionary history

• Pangenome analysis approach:

  • Determine if rnfE belongs to the core genome (shared by all strains) or accessory genome

  • Assess genetic context and synteny around the rnfE gene

  • Identify horizontal gene transfer signatures or recombination events

• Structure-function prediction methods:

  • Use homology modeling to predict RnfE protein structure

  • Map conservation patterns onto structural models

  • Identify functional motifs under selection pressure

Similar pangenome analysis techniques applied to S. schwarzengrund demonstrated a pangenome of 7112 genes, with a core genome of 3374 genes, an accessory genome of 2906 genes, and strain-specific unique genes totaling 835 . This approach allows researchers to place RnfE in its evolutionary context, determining whether it represents an ancient conserved function or a more recently acquired trait.

What role does RnfE play in Salmonella schwarzengrund virulence and pathogenicity?

The contribution of RnfE to Salmonella schwarzengrund virulence can be investigated through several methodological approaches:

• Infection model studies:

  • Compare wild-type and rnfE mutant strains in cell culture invasion assays

  • Assess bacterial survival within macrophages

  • Conduct animal infection models to determine colonization efficiency and disease progression

• Virulence factor expression analysis:

  • Measure expression of known virulence genes in rnfE mutants versus wild-type

  • Evaluate formation of type III secretion systems

  • Assess motility and biofilm formation capability

• Host response evaluation:

  • Analyze host immune response to wild-type versus rnfE mutant infection

  • Measure inflammatory cytokine production

  • Assess host cell death mechanisms triggered by infection

Genomic analysis of S. schwarzengrund has identified 153 virulence genes, including the Saf operon and cdtB gene, which are likely involved in pathogenicity . The interplay between electron transport function and virulence mechanisms may be similar to what has been observed with YqiC, where oligomerization plays a critical role in bacterial pathogenesis, affecting colonization and invasion of host cells .

What are the optimal methods for recombinant expression and purification of RnfE protein?

The expression and purification of recombinant RnfE protein from Salmonella schwarzengrund requires specialized approaches due to its membrane-associated nature:

• Expression system selection:

  • E. coli-based systems: BL21(DE3), C41(DE3), or C43(DE3) strains specialized for membrane protein expression

  • Cell-free expression systems: For avoiding toxicity issues often encountered with membrane proteins

  • Expression vector considerations: Inclusion of solubility tags (MBP, SUMO) and appropriate promoters for controlled expression

• Optimization protocol:

  • Induction conditions: Temperature (16-30°C), inducer concentration, and duration

  • Growth media composition: Addition of glycerol or specific carbon sources

  • Co-expression with chaperones to improve folding

• Membrane protein extraction methodology:

  • Detergent screening (DDM, LDAO, OG) for optimal solubilization

  • Gentle lysis methods to preserve protein-protein interactions

  • Differential centrifugation for membrane fraction isolation

• Purification strategy:

  • Affinity chromatography using engineered tags (His, Strep, FLAG)

  • Size exclusion chromatography for oligomeric state analysis

  • Ion exchange chromatography for further purification

• Quality control measures:

  • Western blotting for identity confirmation

  • Circular dichroism for secondary structure verification

  • Mass spectrometry for intact mass analysis and post-translational modifications

The recombinant RnfE protein, once purified, can be used for structural studies, functional assays, and antibody production for further in vivo studies .

How can researchers evaluate the impact of RnfE mutations on Salmonella schwarzengrund physiology?

Evaluating the impact of RnfE mutations on Salmonella schwarzengrund physiology requires a systematic approach:

• Mutation design strategy:

  • Site-directed mutagenesis targeting conserved residues

  • Domain truncation to assess the contribution of specific protein regions

  • Random mutagenesis followed by phenotypic screening for comprehensive analysis

• Complementation methodology:

  • Construction of expression vectors containing mutant rnfE variants

  • Transformation into rnfE knockout strains

  • Expression verification using RT-qPCR and western blotting

• Physiological assessment protocol:

  • Growth curve analysis under various conditions (different carbon sources, stress conditions)

  • Membrane potential measurements using fluorescent dyes (DiSC3(5), JC-1)

  • Respiration rate determination using oxygen electrode or resazurin-based assays

• Comparative proteomics approach:

  • Analyze differential protein expression in wild-type versus mutant strains

  • Identify compensatory changes in other electron transport components

  • Map protein-protein interaction networks affected by mutations

Similar approaches applied to YqiC have demonstrated that mutations in its coiled-coil region disrupted trimer formation, significantly reducing Salmonella's ability to colonize and invade host cells . This highlights the importance of oligomeric state in protein function and bacterial pathogenesis.

What techniques are most effective for studying RnfE in the context of the complete electron transport chain?

Studying RnfE within the complete electron transport chain requires integrated approaches:

• Respiratory chain reconstitution:

  • Isolation of membrane vesicles containing intact respiratory complexes

  • Measurement of electron transfer between purified components

  • Reconstitution of purified components into proteoliposomes

• Inhibitor studies approach:

  • Use of specific electron transport chain inhibitors to dissect component functions

  • Assessment of RnfE function with various electron donors and acceptors

  • Determination of inhibition kinetics to identify binding sites

• Membrane potential analysis:

  • Measurement of proton translocation using pH-sensitive fluorophores

  • Assessment of membrane potential generation using voltage-sensitive dyes

  • Correlation of electron transport activity with proton motive force generation

• Metabolic flux analysis:

  • Use of isotope-labeled substrates to trace electron flow through metabolic pathways

  • Comparison of wild-type and rnfE mutant strains under various growth conditions

  • Integration of data with computational models of bacterial metabolism

Research on related electron transport proteins like YqiC has revealed interactions with Complex II components (SdhA and SdhB) and ATP synthase, suggesting a role in energy production that affects virulence factor assembly . Similar methodologies could elucidate RnfE's role in the electron transport network of Salmonella schwarzengrund.

How can researchers detect and quantify RnfE expression in different Salmonella schwarzengrund isolates?

Detection and quantification of RnfE expression across different Salmonella schwarzengrund isolates can be accomplished through several complementary methods:

• Transcriptional analysis approach:

  • RT-qPCR optimization for rnfE mRNA quantification

  • RNA-seq for genome-wide expression context

  • Promoter-reporter fusions to study regulation under different conditions

• Protein detection methodology:

  • Western blotting using specific anti-RnfE antibodies

  • Mass spectrometry-based targeted proteomics (MRM/PRM)

  • ELISA development for high-throughput quantification

• In situ visualization techniques:

  • Immunofluorescence microscopy to determine cellular localization

  • GFP fusion proteins to monitor expression in live cells

  • FISH (Fluorescence In Situ Hybridization) for mRNA localization

• High-throughput screening methods:

  • Development of reporter strains for expression monitoring

  • Flow cytometry-based sorting of expression variants

  • Microfluidic approaches for single-cell expression analysis

Expression analysis of electron transport proteins can provide insights into adaptation to different environments and hosts. Techniques similar to those used in Real-Time PCR assays for Salmonella detection can be adapted for gene expression studies, including optimization of DNA extraction protocols and PCR cycling conditions .

What bioinformatic tools are most valuable for analyzing RnfE sequence, structure, and function?

Bioinformatic analysis of RnfE requires a comprehensive toolkit:

• Sequence analysis software:

  • BLAST and HMMER for homology detection

  • Clustal Omega or MUSCLE for multiple sequence alignment

  • MEGA or RAxML for phylogenetic analysis

  • ConSurf for evolutionary conservation mapping

• Protein structure prediction tools:

  • AlphaFold or RoseTTAFold for 3D structure prediction

  • SWISS-MODEL for homology modeling

  • PredictProtein for secondary structure prediction

  • TMHMM or TOPCONS for transmembrane topology prediction

• Functional analysis resources:

  • InterProScan for domain and motif identification

  • STRING for protein-protein interaction prediction

  • KEGG for metabolic pathway mapping

  • UniProt for functional annotation integration

• Data integration platforms:

  • Cytoscape for network visualization

  • R or Python with BioConductor/Biopython for custom analyses

  • Galaxy for reproducible workflow development

  • Integrated Genome Browser for genomic context visualization

The amino acid sequence of RnfE (MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYV...) can be analyzed to predict transmembrane regions, functional domains, and evolutionary conservation patterns crucial for understanding its role in the electron transport chain .

How do different growth conditions affect RnfE expression and function in Salmonella schwarzengrund?

The impact of environmental conditions on RnfE expression and function can be methodically investigated:

• Controlled culture conditions approach:

  • Growth in different carbon sources (glucose, glycerol, succinate)

  • Variation in oxygen availability (aerobic, microaerobic, anaerobic)

  • Exposure to different stress conditions (pH, osmotic stress, nutrient limitation)

  • Simulation of host environments (low pH, bile salts, antimicrobial peptides)

• Expression profiling methodology:

  • Transcriptomics (RNA-seq or microarray) under various conditions

  • Proteomics to correlate transcript and protein levels

  • Reporter gene fusions to monitor real-time expression changes

  • ChIP-seq to identify regulatory proteins controlling rnfE expression

• Functional assessment protocol:

  • Measurement of electron transport activity using artificial electron donors/acceptors

  • Determination of growth rates and yields under different conditions

  • Assessment of virulence factor expression in response to environmental changes

  • Metabolomic analysis to identify altered metabolic pathways

• Comparative analysis framework:

  • Correlation of expression patterns with other electron transport components

  • Comparison with known stress response systems

  • Integration of data with computational models of bacterial metabolism

Understanding how growth conditions affect RnfE expression can provide insights into Salmonella's adaptation to different environments, including those encountered during infection. Similar approaches have revealed that electron transport chain components like YqiC interact with other proteins in ways that modulate energy production and virulence factor assembly .

How can understanding RnfE function contribute to new antimicrobial development strategies?

Understanding RnfE function provides several avenues for antimicrobial development:

• Target validation methodology:

  • Essentiality assessment through conditional knockdown systems

  • Fitness contribution analysis in various infection models

  • Structural analysis to identify druggable pockets or interfaces

  • Comparison with human proteins to ensure specificity

• Inhibitor discovery approach:

  • Structure-based virtual screening against RnfE models

  • Fragment-based drug discovery to identify initial chemical matter

  • High-throughput screening of compound libraries against purified RnfE

  • Phenotypic screening using reporter strains sensitive to electron transport disruption

• Combination therapy strategy development:

  • Synergy testing with existing antibiotics

  • Evaluation of resistance development frequency

  • Assessment of efficacy against persister cells

  • Investigation of host-directed therapies that complement RnfE inhibition

• Alternative approaches exploration:

  • Development of peptide inhibitors targeting protein-protein interactions

  • Design of nucleic acid-based therapeutics (antisense, CRISPR) targeting rnfE

  • Immunization strategies using RnfE as an antigen

  • Bacteriophage engineering to target RnfE-dependent processes

Genomic analysis has revealed that S. schwarzengrund strains exhibit resistance to multiple antibiotics, including amikacin, ciprofloxacin, sulfamethoxazole, streptomycin, and tetracycline . Novel targets in the electron transport chain could provide alternatives to conventional antibiotics facing resistance issues.

What are the most significant technical challenges in studying membrane-associated proteins like RnfE?

Investigating membrane-associated proteins like RnfE presents several technical challenges that require specialized approaches:

• Expression and purification obstacles:

  • Protein toxicity during overexpression

  • Difficulty maintaining native conformation during extraction

  • Low yields compared to soluble proteins

  • Requirement for detergents or lipid environments

• Structural analysis limitations:

  • Challenges in crystallization for X-ray diffraction

  • Size constraints for NMR studies

  • Sample heterogeneity issues for cryo-EM

  • Difficulty in capturing dynamic conformational changes

• Functional assay development challenges:

  • Reconstitution of activity in artificial membrane systems

  • Maintaining protein stability during assays

  • Distinguishing direct from indirect effects in complex systems

  • Replicating native lipid environment for optimal function

• Interaction studies complications:

  • False negatives in traditional yeast two-hybrid systems

  • Detergent interference with protein-protein interactions

  • Transient interactions difficult to capture

  • Artificial aggregation during concentration steps

These challenges necessitate specialized approaches beyond those used for soluble proteins. Successful strategies often combine multiple complementary techniques and careful optimization of conditions for each specific membrane protein.