Recombinant Salmonella schwarzengrund Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdC; SeSA_A4611; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGF VGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVV TVVILYVALFW
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase is used in aerobic growth. FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Fumarate Reductase Subunit C in Salmonella schwarzengrund and What is its Function?

Fumarate reductase subunit C (frdC) in Salmonella schwarzengrund is a 15 kDa hydrophobic membrane protein that serves as an essential component of the fumarate reductase enzyme complex. The protein consists of 131 amino acids and is encoded by the frdC gene (locus name SeSA_A4611) . As part of the membrane-bound fumarate reductase complex, frdC plays a crucial role in anchoring the enzyme to the bacterial membrane through its five membrane-spanning helical segments. Based on studies of similar proteins in other bacteria, such as Wolinella succinogenes, frdC typically binds two heme b molecules that participate in electron transfer pathways .

The fumarate reductase complex, including the frdC subunit, essentially performs the reverse reaction of succinate dehydrogenase (complex II) of the aerobic respiratory chain. This reversibility allows bacteria like Salmonella to adapt their metabolism based on environmental oxygen availability, which is particularly important during infection when the pathogen encounters oxygen-limited environments within the host .

How Does the Structure of frdC Contribute to the Function of the Fumarate Reductase Complex?

A critical structural feature of frdC is its ability to bind two heme b molecules, which are essential for the electron transfer function of the enzyme . These heme groups are strategically positioned within the membrane domain to facilitate electron transfer from membrane-soluble quinol molecules to the iron-sulfur centers in subunit B, and ultimately to the flavin adenine dinucleotide (FAD) cofactor in subunit A where fumarate reduction occurs. The specific arrangement of the transmembrane helices creates binding pockets for the heme groups and forms a pathway for quinol/quinone interactions.

The hydrophobic nature of the frdC amino acid sequence, which includes stretches of nonpolar residues interspersed with charged residues at strategic positions, is critical for proper membrane insertion and stability . This specialized structure allows frdC to interface with the lipid bilayer while facilitating interactions with the hydrophilic catalytic domains. The relative orientation between the membrane-embedded frdC and the soluble components (subunits A and B) appears to be unique among succinate:quinone oxidoreductases, suggesting specific adaptations for the directional flow of electrons during the fumarate reduction reaction .

What is the Difference Between Membrane-Bound and Soluble Fumarate Reductases?

Membrane-bound and soluble fumarate reductases represent two distinct classes of enzymes that catalyze the reduction of fumarate to succinate but differ significantly in their structure, localization, and biochemical properties. Membrane-bound fumarate reductases, which include the Salmonella schwarzengrund frdC-containing complex, are typically composed of multiple subunits that anchor to the cytoplasmic membrane through hydrophobic membrane-spanning segments . These enzymes couple fumarate reduction directly to the electron transport chain, utilizing quinol as an electron donor and contributing to energy conservation through the generation of proton motive force.

In contrast, soluble fumarate reductases are cytoplasmic proteins that function independently from the electron transport chain. These enzymes have been identified in several bacteria including Shewanella species, as well as in the protozoan Trypanosoma brucei and in yeast . Soluble fumarate reductases typically utilize NADH or FADH2 directly as electron donors, offering a more direct but less energy-efficient means of maintaining redox balance under anaerobic conditions.

A fundamental biochemical difference between these two classes lies in their FAD cofactor binding and redox potential. The membrane-bound fumarate reductases contain covalently bound FAD with a high redox potential, and they can catalyze the fumarate-succinate conversion reversibly . In contrast, soluble fumarate reductases contain non-covalently bound FAD with a low redox potential and catalyze an irreversible reaction . This difference in reversibility has important implications for the metabolic flexibility of organisms possessing these different enzyme types.

The distribution of these two types of fumarate reductases across different organisms appears to reflect their ecological niches and metabolic requirements. Most organisms, including Salmonella species, primarily utilize the membrane-bound form, which is more efficient for energy conservation during anaerobic respiration . The soluble form may provide additional metabolic flexibility in environments with fluctuating oxygen availability or serve as an overflow mechanism when membrane-bound enzyme capacity is exceeded.

How is frdC Expression Regulated Under Aerobic vs. Anaerobic Conditions?

The expression of frdC, along with the other subunits of the fumarate reductase complex, is tightly regulated in response to oxygen availability, reflecting its primary role in anaerobic respiration. Under aerobic conditions, when oxygen serves as the preferred terminal electron acceptor, the expression of the frd operon (which includes frdC) is strongly repressed through multiple regulatory mechanisms. This repression involves oxygen-sensing transcription factors that respond directly to oxygen levels or indirectly to the redox state of the cell.

When bacteria transition to anaerobic environments, this repression is relieved, and expression of the fumarate reductase complex is induced. In Enterobacteriaceae including Salmonella, this regulation is primarily mediated by the FNR (fumarate and nitrate reduction) regulator, which contains an oxygen-labile iron-sulfur cluster that serves as an oxygen sensor . Under anaerobic conditions, the active form of FNR binds to specific promoter regions upstream of the frd operon, activating transcription. Additional regulation comes from the two-component regulatory systems ArcA/ArcB and NarL/NarX, which respond to the cellular redox state and the presence of alternative electron acceptors such as nitrate.

The induction of frdC expression coincides with a metabolic shift toward anaerobic respiration, where alternative electron acceptors like fumarate become essential for maintaining redox balance in the absence of oxygen. This metabolic adaptation is particularly important for facultative anaerobes like Salmonella that may encounter varying oxygen concentrations during host infection . The carefully orchestrated regulation ensures that the energetically expensive synthesis of membrane-bound fumarate reductase occurs only when appropriate for the environmental conditions.

Interestingly, certain environmental factors beyond oxygen availability can also influence frdC expression. These may include carbon source availability, growth phase, and host-derived signals encountered during infection. In pathogenic bacteria like Salmonella, this regulation is integrated with virulence gene expression networks, allowing coordinated adaptation to the host environment where oxygen limitation often coincides with other specific host-associated signals.

What Are the Optimal Conditions for Expressing Recombinant Salmonella schwarzengrund frdC in Laboratory Settings?

Expressing recombinant Salmonella schwarzengrund frdC presents several challenges due to its hydrophobic nature and membrane-associated properties. The optimal expression system typically depends on the intended downstream applications and whether the protein needs to be functionally active or simply produced for structural or immunological studies. For high-yield expression of membrane proteins like frdC, E. coli is often the preferred host organism due to its rapid growth, well-characterized genetics, and availability of specialized expression strains designed for membrane proteins.

Growth conditions significantly impact the successful expression of frdC. Lower temperatures (16-25°C) after induction often improve the proper folding and membrane integration of membrane proteins by slowing down protein synthesis. Additionally, the growth medium composition can be optimized to include supplements that assist membrane protein folding, such as increased concentrations of specific ions or the addition of compatible solutes. For frdC expression, anaerobic or microaerobic conditions might better mimic the native environment where this protein functions, potentially improving proper folding and stability.

Induction parameters require careful optimization when expressing membrane proteins like frdC. Lower inducer concentrations and longer expression times often yield better results than strong, short-duration induction. For example, using 0.1-0.5 mM IPTG (for T7-based systems) rather than the standard 1 mM, and extending expression time to 16-24 hours at lower temperatures can significantly improve the yield of properly folded frdC. Monitoring the growth curve during expression is essential, as membrane protein overexpression frequently leads to growth inhibition, which can be used as an indicator to adjust expression conditions.

How Can I Assess the Purity and Activity of Recombinant frdC After Purification?

Western blotting offers a more specific verification of identity, using antibodies against frdC itself or against any fusion tags incorporated into the recombinant construct. This technique is particularly valuable when expression levels are low or when distinguishing between the target protein and similarly sized host proteins. Additionally, mass spectrometry analysis (particularly MALDI-TOF or ESI-MS) can provide definitive identification based on peptide mass fingerprinting, while also potentially revealing any post-translational modifications or unexpected truncations in the recombinant protein.

Functional activity assessment of recombinant frdC is more challenging as it normally functions as part of the multi-subunit fumarate reductase complex. The most direct approach is reconstitution with the other fumarate reductase subunits (frdA and frdB) to form the complete enzyme complex, followed by activity measurements. Fumarate reductase activity can be assessed spectrophotometrically by monitoring the oxidation of reduced benzyl viologen or methyl viologen (artificial electron donors) at 578 nm as fumarate is reduced to succinate. Alternatively, the binding of heme groups, which are critical for frdC function, can be evaluated through absorption spectroscopy, with characteristic peaks at approximately 410-420 nm (Soret band) and 500-560 nm (Q bands) indicating successful heme incorporation .

What Expression Systems Are Most Suitable for Producing Functional Salmonella frdC?

Several expression systems can be considered for producing functional Salmonella frdC, each with distinct advantages depending on the intended applications. E. coli-based expression systems remain the most widely used for bacterial membrane proteins due to their simplicity and cost-effectiveness. Specifically, E. coli strains engineered for membrane protein expression, such as C41(DE3) and C43(DE3) (Walker strains), or Lemo21(DE3) with tunable expression, often yield better results for challenging membrane proteins like frdC. These strains contain mutations that help accommodate the increased membrane protein load and reduce toxicity associated with membrane protein overexpression.

For more native-like production of frdC, homologous expression in non-pathogenic Salmonella strains can be advantageous. This approach preserves the native membrane environment and accessory factors that might be important for proper folding and function. The study described in search result demonstrates the feasibility of recombinant protein expression in Salmonella, though for different proteins than frdC. Regulated expression systems using native Salmonella promoters or heterologous systems adapted for Salmonella can be employed, potentially yielding protein with more native-like properties and post-translational modifications.

Cell-free expression systems have emerged as powerful alternatives for producing membrane proteins like frdC. These systems bypass the constraints of cellular viability and can be supplemented with detergents, lipids, or nanodiscs to facilitate proper folding of membrane proteins. Commercial systems based on E. coli extracts can be adapted for membrane protein synthesis by including appropriate lipid vesicles or detergent micelles. The advantage of this approach lies in the direct accessibility to the reaction conditions, allowing rapid optimization and the ability to incorporate modified amino acids if desired for structural or functional studies.

Eukaryotic expression systems may be considered for producing frdC when specific post-translational modifications or higher-order complex formation is required. Yeast systems (Saccharomyces cerevisiae or Pichia pastoris) have been successfully used for bacterial membrane proteins and offer the advantage of eukaryotic-like membrane composition while retaining relatively simple culturing requirements. For larger scale production with proper membrane targeting, insect cell expression using baculovirus vectors provides an additional option, though with increased complexity and cost compared to prokaryotic systems. Each system requires careful optimization of expression constructs, including codon usage, signal sequences, and fusion partners to maximize the yield of functional frdC.

How Can I Design Experiments to Study the Role of frdC in Salmonella Adaptation to Anaerobic Environments?

Designing experiments to study frdC's role in anaerobic adaptation requires a multi-faceted approach combining genetic, biochemical, and physiological methods. Gene deletion studies represent a fundamental starting point, where creating a clean frdC knockout in Salmonella provides a platform for assessing its function. This can be accomplished using lambda Red recombination or CRISPR-Cas9 genome editing to precisely delete frdC while minimizing polar effects on adjacent genes. The resulting ΔfrdC mutant should be characterized for growth defects under various conditions, particularly comparing aerobic versus anaerobic growth with different carbon sources and alternative electron acceptors to establish phenotypes specifically linked to anaerobic respiration.

Complementation studies are essential for confirming phenotype specificity and exploring structure-function relationships. Reintroducing wild-type frdC on a plasmid should restore the wild-type phenotype, while site-directed mutants can identify critical residues involved in membrane anchoring, heme binding, or interaction with other fumarate reductase subunits. For instance, mutations in the putative heme-binding residues would be expected to disrupt electron transfer without affecting membrane integration. Controlled expression using inducible promoters allows titration of frdC levels to determine threshold requirements for function and potentially identify dominant-negative effects from partial complexes.

Physiological characterization under anaerobic conditions provides critical insights into frdC's functional role. Measuring growth rates, cell yields, and nutrient consumption in anaerobic chambers or sealed vessels with appropriate headspace gas composition can quantify the contribution of frdC to Salmonella fitness. Comparing growth on various carbon sources (glucose, glycerol, lactate) with fumarate as the terminal electron acceptor versus alternative acceptors (nitrate, DMSO) can reveal the specificity of the phenotype to fumarate respiration. Metabolomic analysis using techniques like LC-MS can provide a comprehensive view of metabolic pathway adjustments in response to frdC deletion, potentially revealing unexpected compensatory mechanisms.

Competition experiments in mixed cultures offer a sensitive approach to detecting subtle fitness differences. Co-culturing wild-type and ΔfrdC Salmonella under fluctuating oxygen conditions that mimic those encountered during infection can reveal the importance of frdC for adaptation to changing environments. These experiments can be extended to in vivo models, such as mouse or chicken infection models, to assess whether frdC contributes to Salmonella virulence and colonization, particularly in intestinal environments where oxygen gradients are steep. Using fluorescently tagged strains or quantitative PCR for enumeration allows precise determination of competitive indices in different host tissues and under different infection scenarios.

How Can I Design Site-Directed Mutagenesis Experiments to Study the Functional Domains of frdC?

Site-directed mutagenesis of frdC requires a strategic approach targeting specific functional domains based on sequence conservation, structural predictions, and homology to better-characterized fumarate reductases. The first step involves comprehensive sequence alignment of frdC from Salmonella schwarzengrund with homologous proteins from other organisms, particularly those with resolved crystal structures like Wolinella succinogenes . This alignment helps identify highly conserved residues likely critical for function, as well as regions that may confer species-specific properties. Special attention should be paid to predicted transmembrane helices, potential heme-binding sites, and residues at interfaces with other subunits of the complex.

For investigating membrane integration and topology, mutations should target residues in predicted transmembrane segments, particularly focusing on charged or polar residues within these predominantly hydrophobic regions. Such residues often play critical roles in helix-helix interactions or in stabilizing the protein within the membrane environment. Mutating these to alanine or to residues with opposite properties (e.g., changing a charged residue to a hydrophobic one) can reveal their importance in membrane insertion and stability. Additionally, introducing cysteine residues at strategic positions enables subsequent labeling with membrane-impermeable sulfhydryl reagents, providing experimental verification of the predicted membrane topology.

For studying heme binding and electron transfer functions, mutations should focus on the predicted heme-coordinating residues, typically histidines located in specific sequence contexts. Based on homology to the Wolinella succinogenes enzyme, where the frdC subunit binds two heme b molecules , mutations of the corresponding histidine residues in Salmonella frdC would be expected to disrupt heme incorporation and electron transfer. Beyond the direct ligands, mutations in the surrounding amino acids can reveal the extended binding pocket that influences heme orientation and redox properties. These mutations should be characterized by spectroscopic methods to assess heme incorporation and by activity assays to determine the impact on electron transfer rates.

The interface between frdC and the other subunits of the fumarate reductase complex represents another critical target for mutagenesis. Since frdC must interact properly with frdB to enable electron transfer from membrane quinols to the catalytic site, mutations at this interface can reveal the structural determinants of complex assembly and intersubunit communication. Conservative substitutions (maintaining similar physicochemical properties) can be used to fine-tune the analysis of specific interactions. Each mutant should be assessed not only for individual protein stability but also for complex formation using techniques like blue native PAGE or co-immunoprecipitation, followed by activity measurements to correlate structural effects with functional outcomes.

What Techniques Are Most Effective for Studying Membrane Integration of frdC?

Studying the membrane integration of frdC requires specialized techniques that address the challenges inherent to membrane protein analysis. Protease accessibility mapping provides direct experimental evidence of membrane topology by exploiting the differential accessibility of protein regions to proteases. In this approach, spheroplasts or membrane vesicles containing recombinant frdC are treated with proteases like trypsin or proteinase K, which can only access protein domains outside the protected membrane environment. The resulting proteolytic fragments are then analyzed by immunoblotting with domain-specific antibodies or by mass spectrometry to determine which regions were protected, thereby mapping the membrane-embedded segments.

Cysteine scanning mutagenesis combined with accessibility studies represents another powerful approach for mapping membrane topology. This technique involves creating a cysteine-free version of frdC, then systematically introducing individual cysteines at positions throughout the protein. These single-cysteine variants are then expressed and treated with membrane-impermeable sulfhydryl reagents like maleimide-PEG. Only cysteines exposed to the aqueous environment will be labeled, while those buried in the membrane remain protected. The pattern of labeling across the entire set of variants reveals the topology of the protein relative to the membrane, providing experimental verification of computational predictions about the five transmembrane helices expected in frdC .

Fluorescence techniques offer dynamic insights into membrane protein integration and folding. Fusing environment-sensitive fluorescent tags like CFP or YFP to different domains of frdC can report on their localization relative to the membrane. Alternatively, site-specific labeling with environment-sensitive dyes at engineered cysteine residues can provide detailed information about the local environment of specific protein regions. Fluorescence resonance energy transfer (FRET) between donor-acceptor pairs placed at strategic positions can measure intramolecular distances and detect conformational changes that may occur during membrane insertion or in response to different physiological conditions.

Advanced structural biology techniques provide the most detailed view of membrane integration. While challenging for membrane proteins, cryo-electron microscopy (cryo-EM) has revolutionized the field by enabling structure determination without crystallization. For frdC as part of the fumarate reductase complex, cryo-EM could reveal how the protein's transmembrane helices are arranged within the membrane and how they coordinate heme groups. Complementary approaches include solid-state NMR spectroscopy, which can provide atomic-level details about protein-lipid interactions and dynamics within the membrane environment. These structural studies would benefit from reconstitution of frdC into nanodiscs or liposomes that mimic the native membrane environment, potentially including specific lipids found in Salmonella membranes to capture physiologically relevant interactions.

How Does the Interaction Between frdC and Other Subunits of the Fumarate Reductase Complex Affect Enzyme Activity?

The interaction between frdC and other subunits of the fumarate reductase complex is fundamental to the enzyme's function, establishing an electron transfer pathway from membrane quinols to the catalytic site. Based on structural studies of homologous enzymes like that from Wolinella succinogenes, frdC interacts primarily with the iron-sulfur protein (frdB) to form a connected electron transport chain . This interaction must be precisely oriented to allow efficient electron transfer from the heme groups in frdC to the iron-sulfur clusters in frdB, and ultimately to the FAD cofactor in the catalytic subunit (frdA) where fumarate reduction occurs. Any disruption in these protein-protein interfaces can potentially break the electron transfer pathway, rendering the enzyme inactive despite all cofactors being present.

The specific molecular details of these subunit interactions can be investigated through a combination of site-directed mutagenesis and biochemical characterization. Creating chimeric proteins where segments of frdC are exchanged with homologous regions from related organisms can identify domains specifically involved in species-specific subunit recognition. Co-purification experiments with tagged versions of individual subunits can assess the impact of mutations on complex formation, while blue native PAGE can evaluate the stability of the assembled complex. These biochemical approaches should be complemented by functional assays measuring electron transfer rates and fumarate reduction activity to correlate structural perturbations with functional outcomes.

Interestingly, the stoichiometry and arrangement of subunits within the complex can also influence enzyme activity. The membrane-bound fumarate reductase typically exists as a heterotrimeric complex (frdABC) or heterotetramer (frdABCD in some organisms) . The precise assembly pathway and potential intermediate subcomplexes may play regulatory roles in enzyme function. Controlled expression systems allowing manipulation of individual subunit levels can reveal threshold requirements and identify rate-limiting components in complex assembly. Moreover, the supramolecular organization of multiple fumarate reductase complexes within the membrane may create localized respiratory domains that enhance catalytic efficiency through substrate channeling or localized proton management.

Beyond static structural considerations, dynamic aspects of subunit interactions likely play important roles in regulating enzyme activity. Conformational changes in response to substrate binding, redox state changes, or membrane potential may modulate the efficiency of electron transfer between subunits. Advanced techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) or site-specific crosslinking can capture these dynamic interactions, potentially revealing regulatory mechanisms that adjust enzyme activity in response to environmental conditions. Understanding these subunit interactions at both structural and dynamic levels provides insights into how bacteria like Salmonella modulate their respiratory metabolism in changing environments, particularly during host infection where oxygen availability fluctuates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.