Recombinant Salmonella schwarzengrund Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock
Cat. No.
BT2448857
Source
in vitro E.coli expression system
Synonyms
mscL; SeSA_A3607; Large-conductance mechanosensitive channel
Quick Inquiry

Description

General Information

Recombinant Salmonella schwarzengrund Large-conductance mechanosensitive channel (mscL) is a protein expressed in Salmonella schwarzengrund and is involved in response to osmotic stress . MscL proteins are known to form channels in cell membranes that open in response to mechanical stimuli, thereby helping cells to maintain their structural integrity under stress .

Characteristics

CharacteristicsDescription
OrganismSalmonella schwarzengrund
Protein TypeLarge-conductance mechanosensitive channel (mscL)
Recombinant ProteinExpressed using recombinant DNA technology
PurityGreater than 85% as determined by SDS-PAGE
Protein Size139 amino acids
Protein SequenceMKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILATEIKQQNPQLHETLLTHLEQLQQHQGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
Storage BufferTris-based buffer, 50% glycerol
ApplicationsWB (Western Blot), ELISA
Predicted SpeciesSalmonella schwarzengrund
Reconstitution & StorageLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C. Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week .

Function and Significance

MscL channels are crucial for bacterial survival under hypo-osmotic conditions . When bacteria are subjected to sudden decreases in external osmolarity, water rushes into the cell, causing the cell membrane to stretch. MscL channels respond to this membrane tension by opening a pore, allowing solutes to exit the cell, thereby reducing turgor pressure and preventing lysis .

Antimicrobial Resistance in Salmonella Schwarzengrund

Salmonella Schwarzengrund is an increasingly prevalent serovar with notable antimicrobial resistance (AMR) . Recent studies have highlighted a rise in infections caused by S. Schwarzengrund, accompanied by growing concerns about AMR levels within these strains .

  • Many S. Schwarzengrund isolates exhibit high resistance to streptomycin, sulfamethoxazole, and oxytetracycline .

  • The presence of specific resistance genes, such as aphA1 (associated with kanamycin resistance), has been detected in S. Schwarzengrund isolates .

  • Some strains have shown resistance to quinolones and ciprofloxacin .

  • In Taiwan, a study found that 30% of S. Schwarzengrund strains from retail chicken meat were resistant to antibiotics .

  • The first Salmonella serotype in the U.S. found to be resistant to fluoroquinolones was S. Schwarzengrund, identified in a patient who had traveled to the Philippines .

Figure 3. Minimum spanning tree analyses based on the AMR (panel (A)) and plasmid transfer gene (B) profiles of the isolates included in this study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; SeSA_A3607; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
mscL
Target Protein Sequence
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS
Uniprot No.
B4TXB4

Target Background

Function
A mechanosensitive channel that opens in response to membrane stretch forces. It may play a regulatory role in cellular osmotic pressure changes.
Database Links

KEGG: sew:SeSA_A3607

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.