Recombinant Salmonella schwarzengrund Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Role of LspA in Bacterial Physiology and Pathogenicity

LspA is indispensable in Gram-negative bacteria, including Salmonella, due to its role in lipoprotein maturation. Key functions include:

  • Substrate Processing: Cleaves the N-terminal signal peptide of lipoproteins, enabling their integration into the outer membrane .

  • Virulence: Lipoproteins are critical for bacterial adhesion, immune evasion, and nutrient uptake; improper processing compromises pathogenicity .

  • Antibiotic Target: LspA is inhibited by antibiotics like globomycin, which stabilizes intermediate conformations to block signal peptide cleavage .

In S. Schwarzengrund, genomic analyses reveal that LspA is encoded on plasmids (e.g., pESI-like megaplasmids) alongside antimicrobial resistance (AMR) genes, suggesting co-selection pressures .

Recombinant LspA Production and Characterization

While no published protocols specifically detail S. Schwarzengrund LspA expression, methodologies from related bacteria (e.g., Pseudomonas aeruginosa) provide a template:

Expression and Purification

  • Cloning: The lspA gene is cloned into vectors (e.g., pET28b) with affinity tags (e.g., 6xHis) for purification .

  • Host Systems: Expressed in E. coli under optimized conditions (e.g., induction with IPTG or arabinose-regulated promoters) .

  • Purification: Detergent-solubilized LspA is purified via nickel-affinity chromatography, yielding >85% purity .

Genomic and Resistance Context in S. Schwarzengrund

LspA’s genetic environment in S. Schwarzengrund plasmids highlights its clinical relevance:

Plasmid-Associated AMR Genes

Plasmid TypeKey GenesResistance Profile
pESI-likelspA, aadA1, tetAStreptomycin, Tetracycline
IncFIB-IncFIC(FII)aphA1, sul1Kanamycin, Sulfonamides

Horizontal Gene Transfer (HGT)

  • Conjugation experiments show limited transfer of plasmid-borne lspA under laboratory conditions .

  • Phylogenetic analyses indicate clonal spread of LspA-containing plasmids among S. Schwarzengrund isolates from poultry and humans .

Therapeutic Implications and Challenges

  • Drug Design: Structural plasticity of LspA complicates inhibitor development but offers multiple targeting sites .

  • Resistance Avoidance: High conservation of active-site residues reduces mutation-driven resistance risks .

  • Current Limitations: No commercial antibiotics targeting LspA exist; globomycin remains experimental .

Future Research Directions

  1. Heterologous Expression: Optimize recombinant S. Schwarzengrund LspA production for crystallography and inhibitor screening.

  2. Mechanistic Studies: Validate conformational states using cryo-EM and substrate-binding assays.

  3. Epidemiological Tracking: Monitor plasmid-mediated lspA spread in AMR surveillance programs .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific requirement for the format, please indicate your preference in the order notes. We will prepare the product according to your demand.
Lead Time
The delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; SeSA_A0051; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
lspA
Target Protein Sequence
MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what is its function in bacterial systems?

Lipoprotein signal peptidase (LspA), also known as prolipoprotein signal peptidase or signal peptidase II (SPase II), is an aspartyl protease that performs the second critical step in the bacterial lipoprotein processing pathway . Its primary function is cleaving the transmembrane helix signal peptide from lipoproteins after they have been lipidated by lipoprotein diacylglyceryl transferase (Lgt) . This processing is essential for proper lipoprotein localization and function in bacterial cell membranes.

The enzymatic activity of LspA (EC 3.4.23.36) is fundamental to bacterial survival, particularly in Gram-negative bacteria where the pathway is essential, while in Gram-positive bacteria like Staphylococcus aureus, it contributes significantly to virulence . This makes LspA an attractive target for antimicrobial development.

How is recombinant S. schwarzengrund LspA typically expressed and purified?

Recombinant S. schwarzengrund LspA is commonly expressed using Escherichia coli expression systems . The production involves:

  • Vector construction: The lspA gene (SeSA_A0051) is cloned into an appropriate expression vector, often with an N-terminal histidine tag for purification purposes .

  • Expression conditions: Protein expression is typically induced in E. coli cultures grown to appropriate density, with careful optimization of temperature, inducer concentration, and duration to maximize yield while minimizing toxicity.

  • Membrane protein extraction: As LspA is a membrane protein, specialized detergent-based extraction methods are required. Common detergents include LMNG (lauryl maltose neopentyl glycol) for maintaining protein stability and activity .

  • Purification: Affinity chromatography using the histidine tag is the primary purification method, followed by size exclusion chromatography to ensure homogeneity .

  • Quality control: Analytical techniques such as SDS-PAGE, mass spectrometry, and activity assays verify the purity and functionality of the recombinant protein.

For experimental applications, researchers should note that expression of membrane proteins like LspA can be challenging due to potential toxicity to the host cells, which may require optimization of expression conditions or use of specialized expression systems .

What experimental methods are commonly used to assay LspA activity?

Several complementary methods are used to assess LspA activity and inhibition:

1. Gel-shift activity assay
This coupled assay system monitors the sequential processing of prelipoproteins:

  • Pre-prolipoprotein is first converted to prolipoprotein by Lgt

  • LspA then cleaves the prolipoprotein

  • Reaction products are separated by SDS-PAGE, where cleaved and uncleaved forms show different mobility

  • Typical conditions include: 12 µM pre-proICP substrate, 250 µM DOPG lipids, 1.2 µM Lgt, and 0.5 µM LspA in buffer containing 50 mM Tris/HCl pH 7.5, 150 mM NaCl, 1 mM DTT, and 0.02% LMNG

2. FRET-based assays
Fluorescence resonance energy transfer assays utilize fluorescently labeled substrate analogs to monitor cleavage in real-time .

3. Inhibition studies
Dose-response assays with inhibitors like globomycin or myxovirescin allow determination of IC50 values:

  • Inhibitor concentrations typically range from 0 to 3.2 mM

  • Reactions proceed for 30 minutes before being stopped and analyzed

4. Conformational analysis
To understand LspA dynamics:

  • Electron paramagnetic resonance (EPR) spectroscopy captures conformational states

  • Molecular dynamics (MD) simulations predict protein behavior in membrane environments

  • Both approaches combined provide insights into the protein's conformational ensemble

How does the conformational dynamics of LspA relate to its function?

LspA exhibits remarkable conformational flexibility that is directly related to its catalytic function:

Conformational States: LspA exists in at least three conformational states characterized by the position of the periplasmic helix (PH) relative to the β-cradle :

StatePH-β-cradle DistanceFunctional SignificancePopulation
Closed~6.2 ÅOccluded active site; protects charged residues from membraneDominant in apo state
IntermediateMediumPotential antibiotic-bound or transition stateCommon with globomycin bound
OpenLargestRequired for substrate entry and bindingMinor population

Functional Implications:

  • The nanosecond timescale fluctuations between states enable LspA to sample conformations necessary for substrate binding while protecting the charged active site from the hydrophobic membrane environment

  • The open conformation creates a trigonal cavity where the lipoprotein substrate can bind in the correct orientation for cleavage

  • Antibiotic binding (e.g., globomycin) stabilizes intermediate conformations that prevent substrate access to the active site

This conformational plasticity explains how LspA can accommodate and process a variety of lipoprotein substrates with different signal peptide sequences, while maintaining specificity for the cleavage site.

What is the role of S. schwarzengrund LspA in antimicrobial resistance?

While LspA itself is not directly involved in conventional antimicrobial resistance mechanisms, understanding its role is important for several reasons:

1. Target for antimicrobial development:
LspA is considered an excellent target for new antibiotics because:

  • It is essential in Gram-negative bacteria

  • It contributes to virulence in Gram-positive bacteria

  • The highly conserved active site makes resistance mutations less likely as they would interfere with normal enzyme function

2. Context of S. schwarzengrund antimicrobial resistance:
S. schwarzengrund strains are increasingly showing antimicrobial resistance:

  • Analysis of 2,058 isolates found 61.7% carried at least one antimicrobial resistance (AMR) gene

  • Common resistance genes include aph(3'')-Ib (47.1%), tet(A) (9.2%), and sul2 (7.3%)

  • 51.5% carried multiple transfer genes associated with IncFIB-FIC plasmids

3. Recombinant LspA for resistance studies:
Recombinant LspA can be used in screening assays to identify compounds that inhibit this essential enzyme while evading existing resistance mechanisms.

What challenges exist in expressing functional recombinant LspA and how can they be addressed?

Expression of functional recombinant LspA presents several significant challenges:

Toxicity to expression hosts:

  • Expression of membrane proteins like LspA can be toxic to host cells, leading to growth inhibition and reduced yields

  • Example: Expression of recombinant PspA in Salmonella vaccine strains showed toxicity, causing plasmid instability with approximately 50% of cells losing the plasmid after 24 hours of growth

Solution approaches:

  • Use of lower-copy-number plasmids with tightly regulated promoters

  • Development of specialized expression vectors with balanced expression levels

  • Construction of host strains with compensatory mechanisms

Membrane protein solubilization and stability:

  • As an integral membrane protein, LspA requires specialized extraction and purification methods

  • Maintaining the native conformation during purification is critical for functional studies

Solution approaches:

  • Selection of appropriate detergents (e.g., LMNG) that maintain protein stability

  • Inclusion of lipids during purification to mimic the native membrane environment

  • Use of nanodiscs or lipid bilayer mimetics for functional reconstitution

Conformational heterogeneity:

  • LspA exists in multiple conformational states that can complicate structural and functional analyses

Solution approaches:

  • Use of conformation-specific antibodies or nanobodies to stabilize specific states

  • Combined EPR and MD approaches to characterize the conformational ensemble

  • Careful design of constructs for crystallization that maintain functional properties

How can molecular dynamics simulations enhance our understanding of LspA function and inhibitor binding?

Molecular dynamics (MD) simulations have proven valuable for understanding LspA function and can inform drug design efforts:

Conformational dynamics analysis:

  • MD simulations revealed that LspA's periplasmic helix fluctuates on the nanosecond timescale

  • These simulations identified conformational states not observed in crystal structures, including a more open conformation necessary for substrate binding

  • The simulations showed how the closed conformation protects the charged active site residues from the hydrophobic membrane environment

Substrate binding prediction:

  • MD simulations can predict how lipoprotein substrates interact with the active site

  • The simulations suggest a model where the β-cradle and periplasmic helix "clamp" the substrate in place

  • This information can guide the design of substrate analogs as potential inhibitors

Inhibitor binding mechanisms:

  • MD can reveal how inhibitors like globomycin stabilize specific conformational states

  • Simulations have shown multiple binding modes for inhibitors while maintaining interactions with the catalytic dyad

  • This knowledge can inform structure-based design of improved inhibitors with optimized binding properties

Methodology for LspA simulations:

  • The protein should be embedded in a lipid bilayer mimetic that represents the bacterial membrane

  • Both all-atom and coarse-grained simulations can provide complementary insights

  • Analysis should focus on the dynamics of the periplasmic helix and β-cradle regions

  • Simulation results should be validated with experimental techniques like EPR

What is the potential of S. schwarzengrund LspA as a target for novel antimicrobial development?

S. schwarzengrund LspA represents a promising antimicrobial target for several reasons:

Structural and functional advantages:

  • The active site contains highly conserved residues, making resistance mutations less likely

  • Crystal structures of LspA from related organisms (P. aeruginosa and S. aureus) with bound antibiotics provide templates for structure-based drug design

  • The essential nature of LspA in Gram-negative bacteria makes it a potential broad-spectrum target

Known inhibitors as leads:

  • Globomycin and myxovirescin are known LspA inhibitors that bind to the enzyme and prevent signal peptide cleavage

  • While these are not commercially viable antibiotics, they provide valuable insights for drug development

  • Structural studies have revealed how these inhibitors interact with the catalytic dyad

Resistance considerations for S. schwarzengrund:

  • S. schwarzengrund infections are increasing globally with concerning levels of antimicrobial resistance

  • Targeting LspA may provide an alternative approach to combat resistant strains

  • The essential nature of the lipoprotein processing pathway may make resistance development more difficult

Structure-based drug design approaches:

  • The multiple conformational states of LspA suggest that inhibitors could be designed to:

    • Stabilize the closed conformation to prevent substrate binding

    • Compete with substrate for binding in the active site

    • Disrupt the conformational transitions necessary for catalysis

  • Virtual screening against the different conformational states could identify novel inhibitor scaffolds

  • Fragment-based approaches could identify small molecules that bind to specific pockets within the active site

Recombinant protein applications:

  • Recombinant S. schwarzengrund LspA provides a valuable tool for high-throughput screening

  • Coupled enzyme assays and FRET-based methods allow for efficient inhibitor discovery

  • The availability of purified, stable recombinant protein facilitates structural studies to support drug design efforts

How can recombinant S. schwarzengrund LspA be used in vaccine development research?

Recombinant S. schwarzengrund LspA has potential applications in vaccine development through several approaches:

As a component in subunit vaccines:

  • Recombinant LspA could be evaluated as an antigen in subunit vaccine formulations

  • Its conservation across Salmonella species suggests potential cross-protection

As a tool in attenuated Salmonella vaccine development:

  • Understanding LspA function is important when developing attenuated Salmonella strains as vaccine vectors

  • Recombinant Salmonella strains expressing foreign antigens have been extensively studied as promising live vaccine delivery vehicles

  • Experiments have shown that oral immunization with Salmonella-PspA vaccine protected 60% of immunized mice from death after challenge with virulent S. pneumoniae

Addressing challenges in recombinant Salmonella vaccine development:

  • Expression of recombinant proteins in Salmonella can be toxic, affecting plasmid stability

  • Studies found approximately 50% of cells lost the plasmid after 24 hours of growth

  • This necessitates the construction of improved plasmid vectors for stable expression

Pre-existing immunity considerations:

  • Pre-existing Salmonella-specific immunity can interfere with the development of immune responses against Salmonella strains delivering heterologous antigens

  • Research has shown that primary immunization with Salmonella carrier followed by vaccination with antigen-expressing strains results in:

    • Significant reductions in antigen-specific immune responses at week 6 (peak of primary Salmonella-specific antibody responses)

    • No reductions at week 3 and 9

    • Boosted antigen-specific immune responses at week 9 (corresponding to lowest primary Salmonella-specific antibody responses)

Methodological considerations:

  • Timing of vaccination is critical when using Salmonella vectors in previously exposed individuals

  • Researchers should carefully select the time point when carrier-specific immune responses are relatively low to avoid interference

  • Alternative approaches may include using heterologous prime-boost strategies or engineering the vector to reduce immunodominant epitopes

What analytical techniques are most valuable for characterizing the structure-function relationship of recombinant LspA?

A comprehensive understanding of LspA structure-function relationships requires multiple complementary techniques:

Structural analysis techniques:

TechniqueApplication to LspAKey Insights
X-ray crystallographyDetermination of atomic resolution structuresRevealed binding modes of antibiotics like globomycin
Cryo-electron microscopyVisualization of membrane-embedded statesCan capture multiple conformational states
Molecular dynamicsPrediction of conformational dynamicsIdentified open conformation needed for substrate binding
EPR spectroscopyMeasurement of distances between labeled sitesConfirmed existence of multiple conformational states

Functional characterization methods:

Assay TypeMethodologyApplication
Gel-shift assaysMonitor substrate cleavage via electrophoretic mobilityQuantify enzymatic activity and inhibitor potency
FRET-based assaysReal-time monitoring of substrate cleavageHigh-throughput screening of inhibitors
Site-directed mutagenesisSystematic alteration of conserved residuesIdentify catalytically important amino acids
Hydrogen-deuterium exchangeMap solvent accessibility changesIdentify conformational changes upon substrate binding

Integrated approach for structure-function studies:

  • Combine EPR with MD simulations to map conformational states and transitions

  • This hybrid approach has successfully identified protein conformations not observed in crystal structures

  • The combined methods revealed that:

    • LspA samples all three conformations (closed, intermediate, and open) in all states

    • The populations of each conformation vary depending on the state (apo, globomycin-bound, etc.)

    • The periplasmic helix fluctuations occur on the nanosecond timescale

Methodological workflow:

  • Express and purify recombinant LspA with appropriate tags

  • Verify function using activity assays

  • Perform structural analysis using multiple techniques

  • Create site-directed mutants of key residues

  • Assess the effect of mutations on structure and function

  • Conduct inhibitor binding studies

  • Use computational approaches to integrate experimental data

This multifaceted approach provides the most comprehensive understanding of how LspA structure relates to its enzymatic function and inhibitor interactions.

How do the conformational states of LspA influence inhibitor design strategies?

The multiple conformational states of LspA offer diverse opportunities for inhibitor design:

State-specific targeting strategies:

Conformational StateDrug Design StrategyPotential Advantages
ClosedStabilize this state to prevent substrate accessProtects charged active site from membrane
IntermediateMimic globomycin binding modeProven effective with existing inhibitors
OpenBlock the substrate binding cavityPrevents proper substrate positioning

Structure-activity insights from known inhibitors:

  • Globomycin binds to LspA and stabilizes an intermediate conformation

  • This prevents signal peptide cleavage and substrate binding

  • The antibiotic interacts with the catalytic dyad while maintaining different orientations

  • Multiple globomycin binding modes have been observed, suggesting flexibility in inhibitor design

Rational design approaches based on conformational dynamics:

  • Design compounds that bridge between conserved regions that move relative to each other

  • Target "hotspots" that are essential for the conformational transitions

  • Develop allosteric inhibitors that bind outside the active site but influence conformational equilibrium

Methodological workflow for inhibitor discovery:

  • Generate ensemble of LspA conformations using MD simulations

  • Identify binding sites unique to each conformation

  • Perform virtual screening against each conformational state

  • Test hit compounds in biochemical assays

  • Determine binding mode using structural techniques

  • Optimize lead compounds for improved potency and specificity

Advantages of targeting LspA:

  • The extensive conservation of active site residues suggests that resistance mutations would likely interfere with normal enzyme function

  • LspA is essential in Gram-negative bacteria and important for virulence in Gram-positive bacteria

  • These factors make LspA a powerful target to combat the development of antibiotic resistance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.