Recombinant Salmonella schwarzengrund NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; SeSA_A2556; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit A (nuoA) in Salmonella schwarzengrund?

NuoA functions as an integral membrane subunit of the NADH:quinone oxidoreductase complex (Complex I) in S. schwarzengrund. This complex catalyzes the transfer of electrons from NADH to quinones in the respiratory chain while generating proton motive force across the membrane. The nuoA subunit, specifically, contributes to the membrane-embedded domain of the complex that participates in proton translocation. While studies have extensively characterized other nuo subunits like nuoG, nuoM, and nuoN in Salmonella species, nuoA appears to play a complementary role in maintaining the structural integrity and functional efficiency of the complex .

How does nuoA expression correlate with electron transport efficiency in S. schwarzengrund?

NuoA expression directly influences the assembly and efficiency of Complex I, which serves as the primary entry point for electrons into the respiratory chain. Research indicates that under aerobic conditions, Salmonella primarily utilizes ubiquinone as the electron carrier, while under anaerobic conditions, it shifts to demethylmenaquinone and menaquinone. The expression of nuoA and other nuo operon genes is typically regulated in response to oxygen availability and energy demands. Increased expression of NADH:quinone oxidoreductase-1 has been observed in ubiquinone-biosynthesis mutant strains, suggesting compensatory mechanisms to maintain electron flow through alternative quinones . In S. schwarzengrund specifically, nuoA expression patterns would be expected to follow similar regulatory patterns as observed in other Salmonella serovars.

How do mutations in nuoA affect quinone utilization and respiratory flexibility in S. schwarzengrund?

Mutations in nuo genes can significantly alter respiratory capabilities in Salmonella. Research on related nuo subunits has demonstrated that specific mutations can enhance electron transfer to alternative quinones when primary pathways are compromised. For instance, mutations in nuoG (Q297K), nuoM (A254S), and nuoN (A444E) have been shown to improve electron flow activity from NADH to demethylmenaquinone or menaquinone in ubiquinone-deficient strains . By analogy, mutations in nuoA might similarly affect the complex's affinity for different quinone types, potentially enhancing respiratory flexibility under different environmental conditions.

The hydrophobic nature of nuoA suggests that mutations in this subunit could specifically alter membrane integration or subunit interactions within the complex. Methodologically, studying such effects would require generating point mutations in nuoA, followed by characterization of quinone utilization profiles using HPLC analysis of membrane extracts and measuring electron transfer rates with different quinone substrates under varied oxygen tensions .

What is the relationship between nuoA expression and antimicrobial resistance mechanisms in S. schwarzengrund carrying pESI-like plasmids?

S. schwarzengrund has emerged as the third Salmonella serovar to expand its distribution related to pESI-like plasmid acquisition, following S. Infantis and S. Muenchen . These megaplasmids (~280 kb) carry multiple antimicrobial resistance genes and have been associated with enhanced environmental persistence. The relationship between respiratory chain components like nuoA and plasmid-mediated resistance is complex and bidirectional.

The expression of recombinant nuoA may be affected by the metabolic burden imposed by pESI-like plasmids. Conversely, efficient electron transport supported by properly functioning nuoA could provide the energy required for expressing resistance mechanisms encoded by these plasmids. Research methodologies to investigate this relationship should include transcriptomic analysis comparing nuoA expression levels in plasmid-bearing versus plasmid-free isogenic strains, as well as fitness assays under antimicrobial pressure with controlled nuoA expression levels .

How does recombinant nuoA contribute to S. schwarzengrund persistence in agricultural environments?

S. schwarzengrund has been detected in broiler chickens and chicken meat, suggesting adaptation to agricultural settings . The persistence of Salmonella in such environments may be influenced by respiratory flexibility mediated by Complex I components including nuoA. Experimental approaches to investigate this would involve comparative survival studies of wild-type versus nuoA-modified strains in soil microcosms, plant colonization assays, and competition experiments.

Methodologically, researchers could use dialysis tube systems to expose recombinant S. schwarzengrund expressing modified nuoA to plant-derived substrates such as lettuce root exudates, followed by transcriptomic analysis to identify adaptive responses . Such experiments should control for environmental variables including temperature, moisture, and competing microbiota while monitoring bacterial populations over extended periods (e.g., 7, 21, 35, and 49 days) to assess long-term persistence .

What are the optimal conditions for expressing recombinant nuoA from S. schwarzengrund in heterologous systems?

Expression of recombinant nuoA presents several challenges due to its hydrophobic nature as a membrane protein. Researchers should consider the following methodological approach:

  • Vector selection: Use low-copy expression vectors with tunable promoters (e.g., arabinose-inducible pBAD or IPTG-inducible pET systems with T7lac promoters)

  • Host optimization:

    • E. coli C41(DE3) or C43(DE3) strains are recommended as they are engineered for membrane protein expression

    • Consider S. Typhimurium LT2 with nuo deletions as an alternative host for homologous expression

  • Expression conditions:

    • Induce at lower temperatures (16-20°C) to prevent inclusion body formation

    • Use lower inducer concentrations for slower expression rates

    • Supplement with ubiquinone precursors to support proper membrane integration

  • Solubilization and purification:

    • Extract membrane fractions using ultracentrifugation

    • Solubilize with mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

    • Purify using nickel affinity chromatography with His-tagged constructs, followed by size exclusion chromatography

To verify expression and functionality, immunoblotting should be performed using antibodies against epitope tags or the nuoA protein itself, followed by activity assays measuring electron transfer from NADH to various quinone substrates .

What techniques are most effective for creating and verifying site-directed mutations in S. schwarzengrund nuoA?

For creating precise modifications in nuoA, researchers should employ the following methodological approach:

  • Mutation design:

    • Target conserved residues identified through multiple sequence alignments

    • Focus on residues near quinone-binding sites or proton channels

    • Consider charge-altering substitutions that might affect proton translocation

  • Mutagenesis methods:

    • Use overlap extension PCR for introducing specific mutations

    • Alternatively, employ CRISPR-Cas9 genome editing with homology-directed repair

    • For larger modifications, consider lambda Red recombineering

  • Verification procedures:

    • Sanger sequencing to confirm the intended mutation

    • Whole genome sequencing to rule out off-target mutations

    • RT-qPCR to confirm normal transcription levels

  • Functional validation:

    • Measure NADH oxidation rates using membrane vesicles and different quinone substrates

    • Assess proton pumping efficiency using pH-sensitive fluorescent dyes

    • Compare growth rates under different respiratory conditions (aerobic, microaerobic, anaerobic)

When analyzing mutant phenotypes, researchers should compare them to both wild-type and complemented strains to ensure that observed effects are specifically due to the nuoA mutations .

How can researchers effectively measure nuoA-dependent electron transfer in S. schwarzengrund?

To quantify electron transfer mediated by nuoA-containing Complex I in S. schwarzengrund, researchers should implement the following methodological workflow:

  • Membrane preparation:

    • Harvest cells in late exponential phase

    • Disrupt cells using French press or sonication

    • Isolate membrane vesicles through differential centrifugation

  • Enzyme activity assays:

    • Measure NADH oxidation spectrophotometrically at 340 nm

    • Assess quinone reduction using different quinone substrates (ubiquinone, menaquinone, demethylmenaquinone)

    • Determine sensitivity to specific inhibitors (e.g., piericidin A, rotenone)

  • Respiration measurements:

    • Use oxygen electrode systems to measure oxygen consumption rates

    • Perform assays with different electron donors and acceptors

    • Calculate respiratory control ratios

  • Proton translocation:

    • Monitor pH changes using ACMA (9-amino-6-chloro-2-methoxyacridine) fluorescence quenching

    • Determine H⁺/e⁻ ratios using the oxygen pulse method

For comparative analyses, researchers should characterize both wild-type and mutant strains under identical conditions, and use inhibitors specific to Complex I versus alternative NADH dehydrogenases to distinguish nuoA-dependent activities .

How should researchers interpret changes in quinone profiles when analyzing nuoA modifications in S. schwarzengrund?

When analyzing quinone profiles in nuoA-modified S. schwarzengrund strains, researchers should consider the following analytical framework:

  • Quinone extraction and analysis protocol:

    • Extract membrane lipids using chloroform-methanol mixtures

    • Separate quinones by reversed-phase HPLC

    • Detect quinones by UV absorbance (275 nm) and electrochemical detection

    • Quantify relative abundances of different quinone species

  • Expected patterns and interpretation:

    • Wild-type S. schwarzengrund typically produces ubiquinone and menaquinone under aerobic conditions

    • Shifts toward demethylmenaquinone may indicate adaptation to nuoA modifications

    • Reduced total quinone pool often accompanies respiratory chain perturbations

  • Comparative analysis table:

Strain VariantUbiquinoneMenaquinoneDemethylmenaquinoneTotal Quinone Pool
Wild-type+++++++++100%
nuoA deletion++++++++++65-80%
nuoA point mutant+++++++++85-95%
Complemented strain+++++++++95-100%
  • Correlation with phenotypes:

    • Link quinone profile changes to growth rates, motility, and respiratory efficiency

    • Consider whether changes represent compensatory mechanisms or direct effects

    • Analyze gene expression changes in quinone biosynthesis pathways

What statistical approaches are most appropriate for analyzing nuoA expression data across different environmental conditions?

When analyzing nuoA expression across varying environmental conditions, researchers should implement the following statistical approaches:

  • Data normalization strategies:

    • Normalize to multiple reference genes validated for stability under tested conditions

    • Consider geometric averaging of multiple references (GAPDH, gyrA, rpoD)

    • Apply global normalization methods for RNA-seq data

  • Statistical methods for differential expression:

    • For RT-qPCR: Use paired t-tests or ANOVA with post-hoc tests for multiple comparisons

    • For RNA-seq: Apply negative binomial models (DESeq2, edgeR)

    • Calculate fold changes with appropriate confidence intervals

  • Environmental condition comparisons:

    • Analyze expression patterns across oxygen tensions (aerobic, microaerobic, anaerobic)

    • Compare expression in different nutrient availabilities

    • Examine responses to host-relevant conditions (pH, oxidative stress)

  • Multivariate analysis:

    • Perform principal component analysis to identify major sources of variation

    • Use hierarchical clustering to identify co-regulated genes

    • Employ gene set enrichment analysis to identify affected pathways

Researchers should be cautious when interpreting expression changes of single genes like nuoA, as respiratory chain components often show coordinated regulation. Validation of RNA-based findings with protein-level analyses (Western blots, mass spectrometry) is strongly recommended .

How can researchers differentiate between direct effects of nuoA modifications and compensatory adaptations in S. schwarzengrund?

Distinguishing primary effects of nuoA modifications from secondary adaptations requires comprehensive experimental design and careful data interpretation:

  • Time-course analyses:

    • Monitor changes immediately following nuoA modification

    • Track adaptations over extended culturing periods

    • Use inducible systems to observe acute responses to nuoA expression changes

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify rapid changes (likely direct effects) versus delayed responses (adaptations)

    • Construct metabolic flux models to predict system-wide adjustments

  • Genetic approaches:

    • Create double mutants targeting nuoA and potential compensatory pathways

    • Use suppressor mutation analysis to identify genes that can rescue nuoA defects

    • Implement CRISPR interference for transient, titratable repression

  • Phenotypic discrimination matrix:

ParameterDirect nuoA EffectCompensatory Adaptation
TimingImmediate (minutes to hours)Delayed (hours to days)
ReversibilityRapidly reversible upon complementationPersists after complementation
SpecificityPrimarily affects respirationAffects multiple cellular processes
Genetic dependencyStrictly dependent on nuoAMay involve multiple genetic factors

By systematically applying these approaches, researchers can build a comprehensive understanding of how nuoA modifications directly impact S. schwarzengrund physiology versus triggering adaptive responses that may mask or exacerbate primary effects .

What are the most promising applications of recombinant nuoA research in addressing S. schwarzengrund infections?

Research on recombinant nuoA in S. schwarzengrund holds significant potential for developing novel intervention strategies against this pathogen. The respiratory chain represents a vulnerable target that has been relatively unexplored for antimicrobial development. Future research should focus on:

  • Structure-based drug design targeting unique features of nuoA

  • Development of attenuated strains with modified nuoA for potential vaccine candidates

  • Combination approaches targeting both respiratory function and plasmid-mediated resistance

  • Environmental control strategies that exploit respiratory chain dependencies to reduce persistence in agricultural settings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.