Recombinant Salmonella schwarzengrund NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of that tag.
Synonyms
nuoK; SeSA_A2547; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
nuoK
Target Protein Sequence
MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. This process couples the redox reaction with proton translocation (four hydrogen ions translocated across the cytoplasmic membrane for every two electrons transferred), effectively conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is NADH-quinone oxidoreductase and what role does the nuoK subunit play in Salmonella schwarzengrund?

NADH-quinone oxidoreductase (NDH-1) serves as the primary enzyme in the aerobic respiratory chain of Salmonella species. This complex catalyzes electron transfer from NADH to quinones in the bacterial membrane while simultaneously pumping protons across the membrane, contributing to the proton motive force used for ATP synthesis. The complex consists of two main domains: a hydrophilic domain containing the NADH-binding site, flavin-mononucleotide, and iron-sulfur clusters for electron transfer, and a hydrophobic membrane domain that conducts proton translocation .

The nuoK subunit is part of the membrane-embedded hydrophobic domain of NDH-1, similar to the better-characterized NuoL, NuoM, and NuoN subunits. These subunits are homologous to Na+/H+ antiporter complex (Mrp) subunits and contain putative proton-translocation channels . While the specific function of nuoK in S. schwarzengrund has not been fully characterized, comparative genomics suggests its critical role in the proton-pumping machinery of the respiratory complex.

  • How can researchers measure NADH-quinone oxidoreductase activity in Salmonella strains?

Researchers can employ several methodological approaches to specifically measure NDH-1 activity in Salmonella strains:

a) dNADH-oxidase activity assay:

  • Prepare membrane fractions at 80 μg protein/ml in 10 mM potassium phosphate buffer (pH 7.0) containing 1 mM EDTA

  • Initiate reactions by adding 0.15 mM dNADH (deamino-NADH, which is specific for NDH-1 and not utilized by NDH-2)

  • Measure oxidation of dNADH by monitoring decreased absorption at 340 nm

  • Calculate activity using an extinction coefficient of ε340 = 6220 M−1 cm−1 for dNADH

b) dNADH-DB reductase activity assay:

  • Follow the same procedure as above, but include 10 mM KCN and 50 μM DB (2,3-dimethoxy-5-methyl-6-decyl-1,4-benzoquinone)

  • This assay specifically measures electron transfer to the artificial quinone acceptor DB

c) dNADH-K3Fe(CN)6 reductase activity assay:

  • Replace 50 μM DB with 1 mM K3Fe(CN)6

  • Measure reduction of K3Fe(CN)6 at 420 nm

  • Calculate activity using an extinction coefficient of ε420 = 1040 M−1 cm−1 for K3Fe(CN)6

These assays can be validated using Capsaicin-40 as a specific inhibitor of NDH-1 activity .

  • What genetic approaches are available for creating recombinant Salmonella strains with modified nuoK subunits?

Based on approaches used for other nuo genes, several methodological strategies can be employed to create recombinant S. schwarzengrund strains with modified nuoK:

a) Gene replacement with antibiotic marker:

  • Amplify the nuoK gene and flanking regions from S. schwarzengrund genomic DNA

  • Construct a plasmid with the nuoK open reading frame inactivated by insertion of an antibiotic resistance cassette

  • Introduce this construct into S. schwarzengrund through electroporation or conjugation

  • Select for recombinants using appropriate antibiotics

  • Confirm gene replacement through PCR and sequencing

This approach was successfully used to create a nuoG mutant in S. Gallinarum using a kanamycin resistance determinant .

b) Site-directed mutagenesis:

  • Design primers containing specific point mutations in conserved regions of nuoK

  • Use PCR-based site-directed mutagenesis to generate mutated versions of the gene

  • Introduce the mutations into the chromosome using suicide vectors

  • Select for double crossover events that integrate the mutation

  • Verify mutations through sequencing

Table 1: Characteristics of NDH-1 enzyme activity in wild-type versus mutant Salmonella strains

Strain TypedNADH-oxidase activity (% of wild-type)Quinone Species PresentPhenotypic Effects
Wild-type100%Ubiquinone, MenaquinoneNormal motility and growth
Ubiquinone biosynthesis mutants19-90%Demethylmenaquinone, Menaquinone, 2-octaprenyl-6-methoxy-1,4-benzoquinoneReduced motility and growth
Ubiquinone biosynthesis mutants with nuo suppressor mutationsImproved compared to biosynthesis mutants aloneSame as ubiquinone biosynthesis mutantsPartial rescue of motility and growth

Advanced Research Questions

  • How do mutations in different NADH-quinone oxidoreductase subunits affect Salmonella virulence and respiratory function?

The effects of mutations in NDH-1 subunits on Salmonella pathogenesis require comprehensive methodological analysis:

a) Comparative assessment of different nuo mutations:

  • Generate defined mutations in multiple nuo genes including nuoK

  • Measure NDH-1 activity using the previously described enzyme assays

  • Analyze growth curves in different media and under varying oxygen conditions

  • Perform motility assays in soft agar

Research has shown that mutations in nuoG, nuoM, and nuoN can act as suppressors in ubiquinone biosynthesis mutant strains, partially restoring motility and growth. Specifically, mutations like nuoG(Q297K), nuoM(A254S), and nuoN(A444E) were found to improve electron flow activity of NDH-1 under certain growth conditions .

b) Virulence characterization:

  • Assess colonization abilities in animal models

  • Measure invasion and persistence in epithelial cell lines

  • Determine tissue distribution during infection

  • Compare with wild-type strains for virulence attenuation

A nuoG mutation in S. Gallinarum (strain SG9NGK) demonstrated high attenuation in chickens, with less efficient cecal colonization, reduced invasiveness, and no evidence of multiplication in liver or spleen compared to the wild-type parent strain .

  • What is the relationship between quinone pool composition and NADH-quinone oxidoreductase function in Salmonella?

The quinone pool composition significantly impacts NDH-1 function, requiring methodological approaches to characterize this relationship:

a) Quinone analysis:

  • Extract and characterize quinones using reversed-phase HPLC

  • Wild-type Salmonella cells produce ubiquinone and menaquinone

  • Strains with ubiA deletion produce demethylmenaquinone and menaquinone

  • Strains with ubiE deletion produce demethylmenaquinone and 2-octaprenyl-6-methoxy-1,4-benzoquinone

b) Respiratory chain analysis:

Research demonstrates that the total quinone pool is reduced in ubiquinone biosynthesis mutants, leading to decreased NDH-1 activity. Interestingly, NDH-1 enzyme levels (measured by immunoblotting) were increased in these mutants, suggesting a compensatory response .

  • How can researchers analyze the structural characteristics of the nuoK subunit and their functional implications?

Structural analysis of the nuoK subunit requires sophisticated methodological approaches:

a) Homology modeling:

  • Retrieve the amino acid sequence of nuoK from S. schwarzengrund

  • Perform multiple sequence alignment with homologous proteins

  • Use structures of NDH-1 from Thermus thermophilus (3.3 Å resolution) and E. coli (3.0 Å resolution) as templates

  • Generate computational models using programs like SWISS-MODEL or Phyre2

  • Validate model quality through stereochemical and energy analyses

b) Structure-function analysis:

  • Identify conserved residues and potential proton translocation channels

  • Design site-directed mutations based on structural predictions

  • Assess the impact of these mutations on enzyme activity and proton pumping

  • Correlate structural features with functional outcomes

The three largest subunits of the membrane domain (NuoL, NuoM, and NuoN) contain putative proton-translocation channels . Similar structural elements in nuoK would be prime targets for mutational analysis to determine their role in proton translocation.

  • What are the implications of NADH-quinone oxidoreductase mutations for developing attenuated Salmonella vaccine strains?

NDH-1 mutations show significant potential for vaccine development, requiring systematic methodological evaluation:

a) Attenuation assessment:

  • Generate defined mutations in nuoK and other nuo genes

  • Characterize growth defects in various media

  • Assess invasion and persistence in cell culture models

  • Evaluate colonization and clearance kinetics in animal models

b) Vaccine potential evaluation:

  • Determine immunogenicity through antibody and cellular immune response analysis

  • Assess protective efficacy through challenge with virulent strains

  • Optimize vaccination protocols (route, dose, frequency)

  • Compare with other attenuated strains as vaccine candidates

Research with a nuoG mutant in S. Gallinarum demonstrated that a single oral immunization with the live attenuated bacteria reduced mortality following challenge with virulent S. Gallinarum from 75% to less than 8% in 2-week-old chickens . This provides strong evidence that NDH-1 subunit mutations can produce effective vaccine strains, suggesting similar potential for nuoK mutants in S. schwarzengrund.

  • How does plasmid presence affect NADH-quinone oxidoreductase expression and function in Salmonella schwarzengrund?

The interaction between plasmids and NDH-1 function requires comprehensive methodological investigation:

a) Comparative expression analysis:

  • Compare nuo gene expression in strains with and without plasmids using RT-qPCR or RNA-seq

  • Analyze protein levels of NDH-1 subunits through proteomics

  • Assess enzyme activity using the previously described assays

b) Plasmid characterization:

  • Study IncFIB-IncFIC(FII) fusion plasmids found in certain S. schwarzengrund isolates

  • Analyze plasmid sequences for potential regulatory elements affecting nuo genes

  • Perform conjugation experiments to transfer plasmids between strains

Research indicates that S. schwarzengrund isolates carrying IncFIB-IncFIC(FII) fusion plasmids form a distinct subclade in phylogenetic analyses, suggesting plasmid acquisition and maintenance provide selective advantages . These plasmids confer streptomycin resistance and appear to be derived from avian pathogenic plasmids, potentially offering adaptive advantages within avian hosts .

  • How do environmental conditions affect NADH-quinone oxidoreductase function in Salmonella schwarzengrund?

The response of NDH-1 to environmental conditions is crucial for understanding bacterial adaptation:

a) Environmental response characterization:

  • Measure NDH-1 activity under varying oxygen tensions, pH levels, and nutrient conditions

  • Analyze nuo gene expression changes in response to environmental shifts

  • Assess the impact of host-related stressors (bile, antimicrobial peptides, oxidative burst)

b) Host-pathogen interaction studies:

  • Compare invasion and persistence in human intestinal epithelial cells (Caco-2)

  • Analyze invasion rates at 1 hour post-infection and persistence at 48 hours

  • Quantify differences between strains with varying NDH-1 compositions

Experimental data shows significant differences between invasion and persistence capabilities of S. schwarzengrund isolates. For food isolates, the difference between invasion and persistence rates was statistically significant (p = 0.007), while for clinical isolates this difference was non-significant (p = 0.1192) . This suggests that NDH-1 function may contribute differently to adaptation in various host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.