Recombinant Salmonella schwarzengrund p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; SeSA_A3557; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEASRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeA efflux pump subunit and what is its primary function in Salmonella schwarzengrund?

The AaeA protein functions as a membrane fusion protein component of the AaeAB efflux system, which is involved in the extrusion of aromatic carboxylic acids, particularly p-hydroxybenzoic acid (pHBA). Based on studies in related bacteria like Escherichia coli, this efflux pump likely plays a similar role in Salmonella schwarzengrund by removing potentially toxic metabolic intermediates and environmental compounds. The physiological role appears to be as a "metabolic relief valve" that alleviates toxic effects of imbalanced metabolism . The AaeA subunit forms part of a tripartite efflux system that spans the inner membrane, periplasmic space, and outer membrane of this Gram-negative bacterium.

How is the expression of the aaeA gene regulated in Salmonella species?

Studies in E. coli demonstrate that the expression of aaeA is regulated by a LysR-type transcriptional regulator encoded by the aaeR gene. The regulatory mechanism involves several aromatic carboxylic acid compounds serving as inducers of aaeXAB expression, with p-hydroxybenzoic acid (pHBA) being a primary inducer . The regulation likely follows this pathway:

  • Aromatic compounds bind to the AaeR regulator

  • Binding causes conformational changes in AaeR

  • These changes enable transcription of the aaeXAB operon

  • This regulation mechanism represents a specific response to potential toxic compounds that are substrates of the efflux system

While the exact regulatory mechanisms in S. schwarzengrund may have variations, the conservation of these systems across related bacteria suggests similar principles apply.

What is the genetic organization of aaeA in relation to other components of the efflux system?

Based on comparative genomics with E. coli, the aaeA gene in S. schwarzengrund is likely part of an operon that includes:

  • aaeX (previously annotated as yhcR): encodes a small protein without a clearly defined function

  • aaeA (previously annotated as yhcQ): encodes the membrane fusion protein component

  • aaeB (previously annotated as yhcP): encodes the inner membrane transporter component

This operon is regulated by the divergently transcribed aaeR gene, which encodes a protein of the LysR family of transcriptional regulators . The genetic organization reflects the functional relationship between these components, which work together to form a complete efflux system.

What contributes to antimicrobial resistance in Salmonella schwarzengrund strains?

S. schwarzengrund has shown increasing levels of antimicrobial resistance globally. Research has found that 61.7% of analyzed isolates carry at least one antimicrobial resistance gene . The most commonly observed resistance genes include:

Resistance GeneAntibiotic ClassPrevalence (%)
aph(3'')-IbAminoglycoside47.1%
tet(A)Tetracycline9.2%
sul2Sulfonamide7.3%

What is known about the substrate specificity of the AaeAB efflux system?

Research in E. coli has established that the AaeAB efflux system demonstrates narrow substrate specificity. Only a few aromatic carboxylic acids among hundreds of diverse compounds tested were identified as substrates of this efflux pump . This narrow specificity suggests a specialized role in bacterial metabolism rather than a general detoxification function. The primary known substrate is p-hydroxybenzoic acid (pHBA), but other structurally similar aromatic carboxylic acids may also be transported. The specialized nature of this pump distinguishes it from more generalized efflux systems that can transport a wide range of compounds.

What experimental methods are most effective for expressing and purifying recombinant AaeA from Salmonella schwarzengrund?

For effective expression and purification of recombinant S. schwarzengrund AaeA, researchers should implement the following methodological approach:

  • Vector Selection and Construct Design:

    • Use pET expression vectors with a C-terminal His6-tag

    • Include a TEV protease cleavage site for tag removal if needed

    • Optimize codon usage for E. coli expression systems

  • Expression Conditions Optimization:

    • Transform into E. coli BL21(DE3) or C43(DE3) strains (the latter better for membrane proteins)

    • Test induction at lower temperatures (16-20°C) to prevent inclusion body formation

    • Use lower IPTG concentrations (0.1-0.5 mM) for slower, more proper folding

    • Include osmolytes (5% glycerol, 1% glucose) in media to enhance protein stability

  • Membrane Protein Extraction:

    • Harvest cells and disrupt by sonication or high-pressure homogenization

    • Isolate membrane fraction through differential centrifugation (40,000 × g for 30 min followed by 150,000 × g for 1 hour)

    • Solubilize membranes with mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG)

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Size exclusion chromatography for final purification and buffer exchange

    • Verify purity by SDS-PAGE and Western blotting

This approach takes into account the challenges of membrane-associated protein purification while maximizing yield and maintaining protein functionality.

How can researchers effectively measure and quantify AaeA-mediated p-hydroxybenzoic acid efflux?

To quantify AaeA-mediated efflux activity, researchers should employ multiple complementary approaches:

  • Comparative Growth Assays:

    • Culture wild-type and ΔaaeA S. schwarzengrund strains in increasing concentrations of p-hydroxybenzoic acid

    • Monitor growth curves to establish MIC (minimum inhibitory concentration) differences

    • Complement ΔaaeA strains with plasmid-expressed AaeA to confirm phenotype rescue

  • Direct Efflux Measurements:

    • Load bacterial cells with radiolabeled (14C) or fluorescent p-hydroxybenzoic acid derivatives

    • Monitor substrate concentration in cells and medium over time

    • Calculate efflux rates under different conditions (temperature, pH, inhibitors)

  • Analytical Quantification:

    • Use HPLC or LC-MS to directly measure internal and external p-hydroxybenzoic acid concentrations

    • Compare accumulation ratios between wild-type and mutant strains

  • Gene Expression Correlation:

    • Employ qRT-PCR to quantify aaeA expression levels under various conditions

    • Correlate expression levels with measured efflux activity

  • Data Analysis:

    • Calculate key kinetic parameters (Vmax, Km) for the efflux process

    • Develop mathematical models that predict efflux behavior under different conditions

These methodologies provide robust quantification of efflux activity and enable comparison between different experimental conditions or strain variations.

What structural features distinguish the AaeA membrane fusion protein, and how do they contribute to function?

The AaeA protein, as a membrane fusion protein component of a tripartite efflux system, likely possesses several key structural features that facilitate its function:

  • Domain Architecture:

    • N-terminal transmembrane anchor domain: Embedded in the inner membrane

    • Periplasmic α-helical domain: Forms coiled-coil structures spanning the periplasm

    • Lipoyl domain: Contains β-sheet structures involved in protein-protein interactions

    • C-terminal barrel domain: Interacts with outer membrane components

  • Functional Implications:

    • The transmembrane domain anchors the protein and may participate in substrate recognition

    • The periplasmic domain creates a channel through which substrates pass

    • Conserved structural motifs facilitate interactions with AaeB and outer membrane components

    • Flexible regions allow conformational changes during the transport cycle

  • Comparative Analysis:

    • Similar to other membrane fusion proteins involved in efflux systems

    • May contain specialized regions for accommodating aromatic carboxylic acid substrates

    • Likely shares structural homology with other bacterial membrane fusion proteins while maintaining substrate specificity

Structural biology approaches including X-ray crystallography, cryo-electron microscopy, and computational modeling would be necessary to fully characterize these features in S. schwarzengrund AaeA .

What is the role of AaeA in Salmonella virulence and pathogenicity?

The contribution of AaeA to S. schwarzengrund virulence may involve multiple mechanisms, though direct studies on this relationship are currently limited:

  • Host Environment Adaptation:

    • AaeA may help S. schwarzengrund survive in host environments by extruding toxic host-derived compounds

    • Protection against antimicrobial compounds produced by host cells or competing microbiota

  • Metabolic Flexibility:

    • The "metabolic relief valve" function may enhance bacterial fitness during infection

    • Removal of toxic aromatic metabolic intermediates that accumulate under host-associated conditions

  • Potential Connection to Virulence Factors:

    • Research has shown that S. schwarzengrund isolates from various sources (food and clinical) have similar virulence gene profiles

    • Association with plasmids: IncFIB-IncFIC(FII) fusion plasmids have been detected in S. schwarzengrund isolates from both food and clinical sources

  • Comparison with Related Systems:

    • Other efflux systems in related bacteria have been shown to play roles in:

      • Swarming motility (AcrD in S. enterica)

      • Lipid modulation (EmhABC in P. fluorescens)

      • Biofilm formation (multiple systems)

To definitively establish AaeA's role in virulence, in vitro and in vivo infection models comparing wild-type and aaeA deletion mutants would be necessary.

How does genetic variation in aaeA affect efflux pump function across Salmonella schwarzengrund isolates?

Analysis of genetic variation in aaeA across S. schwarzengrund isolates reveals several important considerations for researchers:

  • SNP Distribution and Impact:

    • Non-synonymous SNPs may alter substrate specificity or transport efficiency

    • Mutations in regulatory regions could affect expression levels

    • Strategic points for analysis include the substrate binding domain and protein-protein interaction regions

  • Correlation with Source and Environment:

    • Isolates from different sources (clinical vs. food) may show distinct genetic variations

    • Environmental adaptations may be reflected in sequence polymorphisms

    • Phylogenetic analysis can reveal evolutionary relationships between variants

  • Experimental Approaches to Study Variation Effects:

    • Site-directed mutagenesis to create defined variants

    • Heterologous expression systems to compare efflux efficiency

    • Complementation studies in aaeA knockout strains

    • Structure-function analyses to map critical residues

  • Clinical and Epidemiological Implications:

    • Variants with enhanced efflux capability may contribute to increased virulence

    • Monitoring evolutionary trends in aaeA variation across isolates from different geographical regions

What are the most promising approaches for designing specific inhibitors targeting the AaeA efflux pump component?

Developing inhibitors targeting the AaeA component requires a multi-faceted drug discovery approach:

  • Target Site Identification:

    • Substrate binding pocket within AaeA

    • Interface between AaeA and AaeB

    • Critical residues involved in conformational changes

    • Regions essential for assembly of the tripartite complex

  • Drug Design Strategies:

    • Structure-based design using homology models of AaeA

    • Fragment-based screening to identify initial binding molecules

    • Peptidomimetics that disrupt protein-protein interactions

    • Modified substrate analogs that competitively inhibit transport

  • Screening Methodologies:

    • Virtual screening against predicted binding sites

    • High-throughput functional assays measuring p-hydroxybenzoic acid efflux

    • Thermal shift assays to identify compounds that stabilize AaeA

    • Bacterial growth assays in combination with known antimicrobials

  • Validation Approaches:

    • Direct binding studies (isothermal titration calorimetry, surface plasmon resonance)

    • Crystallography of AaeA-inhibitor complexes

    • Effects on antimicrobial susceptibility in clinical isolates

    • In vivo efficacy in infection models

The development of specific AaeA inhibitors could potentially enhance the efficacy of existing antimicrobials against resistant S. schwarzengrund strains.

How is the aaeA gene distributed across Salmonella serovars, and what does this reveal about its evolutionary history?

Comparative genomic analysis of aaeA across Salmonella serovars provides important evolutionary insights:

  • Phylogenetic Distribution:

    • Present in multiple Salmonella serovars, suggesting an ancient acquisition

    • May show varying degrees of sequence conservation reflecting distinct selective pressures

    • Potential horizontal gene transfer events identifiable through GC content and codon usage analysis

  • Genomic Context Conservation:

    • Consistent operon structure (aaeXAB) across serovars indicates functional importance

    • Conservation of regulatory elements suggests similar control mechanisms

    • Variable elements in promoter regions may indicate adaptation to different niches

  • Correlation with Ecological Niches:

    • Sequence variations may correlate with host range or environmental persistence

    • S. schwarzengrund has become one of the top five Salmonella serovars isolated from retail meat in the U.S. , suggesting potential adaptations to food-related environments

  • Implications for Researchers:

    • Understanding aaeA evolution can inform experimental approaches

    • Conserved regions represent essential functional domains

    • Variable regions may indicate substrate specificity differences

This evolutionary perspective provides context for functional studies and helps identify critical regions for targeted investigation.

What is the relationship between AaeA efflux activity and acquisition of antimicrobial resistance genes in Salmonella schwarzengrund?

The interplay between efflux systems and acquired resistance genes represents an important area for investigation:

  • Co-occurrence Patterns:

    • Analysis of 2,058 S. schwarzengrund isolates showed 61.7% carried at least one AMR gene

    • Common resistance genes included aph(3'')-Ib (47.1%), tet(A) (9.2%), and sul2 (7.3%)

    • Correlation analysis between aaeA expression/variants and specific AMR gene presence is needed

  • Functional Interactions:

    • Efflux systems may provide a baseline resistance that enables acquisition of higher-level resistance genes

    • AaeA-mediated efflux might reduce intracellular antibiotic concentrations below mutation-selection thresholds

    • Combined effects may be synergistic rather than merely additive

  • Mobile Genetic Elements:

    • IncFIB-IncFIC(FII) fusion plasmids have been detected in 17 of 55 studied S. schwarzengrund isolates

    • These plasmids confer streptomycin resistance and might carry other AMR genes

    • The relationship between plasmid acquisition and chromosomal efflux systems requires investigation

  • Research Approaches:

    • Whole genome sequencing of isolates with varying resistance profiles

    • Transcriptomic analysis to correlate aaeA expression with AMR gene expression

    • Phenotypic assays comparing efflux activity in isolates with different AMR gene complements

This research area has significant implications for understanding the evolution of multi-drug resistance in S. schwarzengrund.

What are the critical controls needed when studying recombinant AaeA function in heterologous expression systems?

When studying recombinant AaeA in heterologous systems, researchers must implement rigorous controls:

  • Expression Controls:

    • Empty vector control to establish baseline phenotypes

    • Western blot confirmation of protein expression using tag-specific antibodies

    • Subcellular fractionation to verify proper membrane localization

    • Inducible promoter systems with titrated expression levels

  • Functional Controls:

    • Complementation of E. coli aaeA deletion mutants as positive control

    • Site-directed mutagenesis of predicted critical residues as negative controls

    • Known functional homologs from other species as comparative controls

    • Concentration gradients of p-hydroxybenzoic acid to establish dose-response relationships

  • Specificity Controls:

    • Structurally related compounds to establish substrate specificity

    • Other membrane proteins to control for non-specific membrane effects

    • Co-expression with AaeB to verify complete system functionality

    • Comparison with other known efflux systems

  • System Validation:

    • Multiple expression systems to rule out host-specific effects

    • Different detection methods to confirm efflux activity

    • Varying growth and induction conditions to establish robustness

These controls ensure that observed effects are specifically attributable to AaeA function rather than experimental artifacts or host factors.

How can researchers differentiate between the contribution of AaeA and other efflux systems to antimicrobial resistance phenotypes?

Distinguishing the specific contribution of AaeA from other efflux systems requires targeted experimental approaches:

  • Gene Deletion Strategy:

    • Create single ΔaaeA mutants

    • Generate multiple deletion mutants lacking combinations of efflux systems

    • Construct complementation strains with controlled expression

    • Develop reporter fusions to monitor expression of different efflux systems

  • Substrate Specificity Profiling:

    • Compare resistance profiles against a panel of antimicrobials

    • Focus on p-hydroxybenzoic acid and structurally related compounds

    • Use known specific substrates of other efflux systems as controls

    • Develop a substrate specificity matrix across multiple efflux systems

  • Direct Efflux Measurement:

    • Use specific fluorescent substrates for different efflux systems

    • Apply selective inhibitors where available

    • Measure efflux kinetics under varying conditions

    • Compare efflux rates in single and multiple deletion backgrounds

  • Transcriptional Analysis:

    • Monitor expression of multiple efflux systems under various conditions

    • Identify conditions that differentially regulate aaeA versus other systems

    • Use this information to isolate AaeA-specific contributions

What is the potential role of AaeA in S. schwarzengrund biofilm formation and persistence?

The contribution of efflux systems to biofilm formation represents an emerging area of research:

  • Potential Mechanisms:

    • Removal of toxic metabolites that accumulate in biofilm environments

    • Export of signaling molecules involved in biofilm regulation

    • Maintenance of appropriate intracellular concentrations of aromatic compounds

    • Contribution to stress responses activated during biofilm formation

  • Experimental Approaches:

    • Compare biofilm formation between wild-type and ΔaaeA strains

    • Visualize biofilm architecture using confocal microscopy

    • Analyze biofilm matrix composition for differences

    • Measure expression of aaeA at different biofilm developmental stages

  • Environmental Factors:

    • Test biofilm formation under various stresses (nutrient limitation, oxidative stress)

    • Evaluate persistence in food-related environments, reflecting S. schwarzengrund's prevalence in retail meat

    • Assess biofilm formation on different surfaces relevant to food processing

  • Clinical Implications:

    • Investigate correlation between biofilm formation and clinical isolate characteristics

    • Determine if biofilm-associated strains show altered aaeA expression or sequence variation

    • Evaluate efficacy of efflux inhibitors against biofilm-embedded bacteria

This research direction could provide insights into S. schwarzengrund persistence in food production environments and potential intervention strategies.

How does temperature and environmental stress affect AaeA expression and function in S. schwarzengrund?

Environmental factors likely influence AaeA expression and function substantially:

  • Temperature Effects:

    • Studies in other bacteria have shown that changes in growth temperature altered membrane fatty acid composition and significantly increased expression of efflux pump systems

    • S. schwarzengrund encounters temperature variations in both food production environments and during infection

    • Temperature shifts may affect:

      • Gene expression levels

      • Protein folding and stability

      • Membrane fluidity affecting pump function

      • Substrate specificity profiles

  • Other Environmental Stressors:

    • pH changes: May alter ionization state of substrates and efficiency of transport

    • Osmotic stress: Could affect membrane tension and protein conformation

    • Oxidative stress: May produce damaged metabolites requiring efflux

    • Nutrient limitation: Could modify metabolic pathways producing pump substrates

  • Research Methodology:

    • qRT-PCR analysis of aaeA expression under various stress conditions

    • Reporter fusions to monitor real-time expression changes

    • Functional efflux assays at different temperatures and stress conditions

    • Proteomic analysis to identify post-translational modifications

Understanding these environmental effects is particularly relevant given S. schwarzengrund's presence in various environments from food production to human hosts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.