Recombinant Salmonella schwarzengrund Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Description

Overview and Biochemical Identity

Recombinant Salmonella Schwarzengrund Phosphoglycerol Transferase I (mdoB) is an enzyme encoded by the mdoB gene (also designated opgB or SeSA_A4795 in some strains). It catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDOs), a critical step in bacterial membrane biogenesis . This enzyme is produced recombinantly using heterologous expression systems such as E. coli, yeast, or mammalian cells, achieving ≥85% purity via SDS-PAGE .

Production and Purification

Recombinant variants of this enzyme are generated using multiple host systems:

Host SystemPurityApplications
E. coli≥85%Structural studies, enzymatic assays
Yeast/Baculovirus≥85%High-yield production for biochemical analyses
Cell-Free Expression≥85%Functional studies without host interference

The enzyme’s activity is typically assayed using model substrates like arbutin (p-hydroxyphenyl-β-D-glucoside) .

Functional Role in MDO Biosynthesis

Phosphoglycerol Transferase I is essential for glycerophosphorylation of MDOs, which stabilize bacterial membranes under osmotic stress . Key findings from functional studies include:

  • Catalytic Mechanism: Transfers phosphoglycerol from phosphatidylglycerol to MDOs or arbutin, generating sn-1,2-diglyceride as a byproduct .

  • Genetic Evidence: mdoB mutants (e.g., mdoB::Tn10) lack enzymatic activity and produce MDOs with <3% phosphoglycerol content compared to wild-type strains .

  • Linkage to Pathogenesis: While not directly linked to virulence in S. Schwarzengrund, MDO modifications may influence bacterial adaptation to host environments .

5.1. Membrane Biology Studies

  • Used to investigate MDO biosynthesis and osmoregulation in Salmonella .

  • Serves as a model for phosphoglycerol transfer mechanisms in Gram-negative bacteria .

5.2. Antimicrobial Resistance Context

  • S. Schwarzengrund strains harboring mdoB are often multidrug-resistant, with plasmids carrying genes like blaCMY-2 (cephalosporin resistance) and tet(B) (tetracycline resistance) .

  • Genomic analyses show mdoB is conserved across clinical and food-source isolates, suggesting stability under selective pressures .

Comparative Analysis with Orthologs

The enzyme shares functional homology with E. coli Phosphoglycerol Transferase I but differs in genetic regulation:

FeatureS. Schwarzengrund mdoBE. coli mdoB
Genomic ContextLinked to virulence plasmids Part of osmoregulatory operon
Mutant PhenotypeNo direct virulence impact Impaired osmoregulation
Host AdaptationAssociated with poultry Ubiquitous in gut microbiota

Key Data from Functional Studies

Enzyme Activity in Wild-Type vs. Mutants :

StrainPhosphoglycerol Transferase Activity (nmol/h/mg)Phosphoglycerol in MDOs (mol/mol)
Wild-Type (AB1133)6.02.0
mdoB::Tn10 Mutant<0.090.05

Implications for Future Research

  • Biotechnological Applications: Potential use in synthesizing modified oligosaccharides for industrial purposes.

  • Antimicrobial Strategies: Targeting MDO biosynthesis could disrupt bacterial osmotic adaptation without directly selecting for resistance .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that specific requirements may arise. To ensure your needs are met, please include any format preferences in your order remarks. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: Our standard shipping method includes blue ice packs. If dry ice shipping is preferred, please inform us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. As a standard practice, we include a final concentration of 50% glycerol. Customers can utilize this as a reference point.
Shelf Life
The shelf life of the product is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. To ensure optimal preservation for multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. Should you have a specific tag type in mind, please communicate it to us. We will prioritize development of the specified tag whenever possible.
Synonyms
mdoB; opgB; SeSA_A4795; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
mdoB
Target Protein Sequence
MSELLSVALFLASVLIYAWKAGRNTWWFAATLTVLGLFVILNITLYASDYFTGDGINDAV LYTLTNSLTGAGVGKYILPGIGIALALVAVFGALGWVLRRRRHHPHHVGYSLLALLLALG SVDASPAFRQITELVKSQMRDGDPDFAVYYKEPAKTIPNPKLNLVYIYGESLERTYFDND AFPNLTPELGALKNEGLDFSHTMQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGAEELKTVVADPSYRND WGFYDDTVLDEAWKKFEALSRSGQRFSLFTLTVDTHHPDGFISRTCNRKRYDYDGKPNQS FSAVSCSQENIAEFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFILRG DKPQQETLAVKRNTMDNGATVLDILGGDNFIGLGRSSLSGQSLSEVFLNVKEKVLAMKPD IIRLWNFPKEIKDFTVDRDKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWIDRCYKMAQLWAPALALSTDWCVSQGQLGGQQTVQHVDKAQWQGKTAFKD TMIDMERYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKAPLPKKFDLVITAKAFGDNANRPIPVRVGNEEQTLVLGHDVSTITLHFNNP TDANTLVIAPPAPVSTNEGNILGHSPRKLGIGMVEIKVVNVEG
Uniprot No.

Target Background

Function
This protein facilitates the transfer of a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol transferase I and what is its biochemical function in bacterial cells?

Phosphoglycerol transferase I is an enzyme localized in the inner cytoplasmic membrane of Gram-negative bacteria that catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDO) or to model substrates like arbutin (p-hydroxyphenyl-β-D-glucoside). The enzyme's active site is positioned on the outer aspect of the inner membrane, allowing it to interact with substrates in the periplasmic space or external medium. The reaction produces phosphoglycerol diester derivatives of MDO and sn-1,2-diglyceride as products, linking phospholipid metabolism to periplasmic oligosaccharide modification .

This enzymatic activity is essential for the proper formation of membrane-derived oligosaccharides, which are found in the periplasmic space of Escherichia coli and other Gram-negative bacteria, potentially including Salmonella schwarzengrund. These structures can constitute up to 7% of the cell's dry weight and play important roles in membrane integrity and bacterial adaptation to environmental stresses .

How is the mdoB gene characterized in bacterial genomes and what phenotypes result from its mutation?

The mdoB gene encodes Phosphoglycerol transferase I and has been mapped to position 99.2 minutes on the E. coli chromosome. In E. coli, mutations in the mdoB gene result in strains that lack phosphoglycerol transferase I activity and are unable to transfer sn-1-phosphoglycerol residues from phosphatidylglycerol to MDO. Consequently, these mutants synthesize membrane-derived oligosaccharides completely devoid of phosphoglycerol residues .

Characterization of mdoB mutants has revealed several notable phenotypic changes:

  • Elevated ethanolamine content in MDO, suggesting a potential compensatory mechanism

  • Unaffected succinate residue content in MDO

  • Resistance to arbutin

  • Dramatically reduced diglyceride accumulation in dgk mdoB double mutants (defective in diglyceride kinase) when grown in medium containing arbutin

These phenotypes have been instrumental in developing genetic selection strategies for isolating mdoB mutants, particularly the arbutin resistance phenotype in dgk backgrounds .

Why is Phosphoglycerol transferase I of interest in Salmonella schwarzengrund research?

While the search results don't directly connect Phosphoglycerol transferase I to S. schwarzengrund specifically, this enzyme is of potential interest in Salmonella research for several reasons. S. schwarzengrund infections have been increasing globally in recent years, with isolates commonly detected in poultry, retail meat, and other foods, leading to multiple outbreaks . The coincident rise in antimicrobial resistance among these strains raises questions about membrane biology and its potential role in pathogenicity and resistance.

Membrane modification enzymes like Phosphoglycerol transferase I influence bacterial cell surface properties, which may affect:

  • Host-pathogen interactions during infection

  • Membrane permeability to antimicrobials

  • Cell envelope stress responses

  • Adaptation to diverse environmental conditions encountered during infection

Understanding membrane-derived oligosaccharide biosynthesis in S. schwarzengrund could provide insights into the species' increasing prevalence and inform strategies to combat infections and antimicrobial resistance.

What techniques have proven effective for isolating and characterizing mdoB mutants?

Researchers have developed several strategic approaches for isolating mdoB mutants:

  • Genetic selection using dgk mutant backgrounds: Strains bearing the dgk mutation (defective in diglyceride kinase) grown in medium containing arbutin accumulate large amounts of sn-1,2-diglyceride, inhibiting growth. A secondary mutation leading to the loss of phosphoglycerol transferase I activity results in arbutin resistance, providing a selective phenotype for isolating mdoB mutants .

  • Biochemical screening: Mutants can be screened for their inability to transfer phosphoglycerol residues to arbutin in vivo or in vitro .

  • MDO composition analysis: Characterization of MDO isolated from mutant strains reveals the absence of phosphoglycerol residues and increased ethanolamine content .

These approaches can be applied to S. schwarzengrund with appropriate modifications for species-specific considerations. For comprehensive characterization, researchers typically combine genetic mapping, complementation studies, and biochemical assays to confirm the mdoB mutation and its effects on phosphoglycerol transferase I activity.

How can recombinant S. schwarzengrund Phosphoglycerol transferase I be expressed and purified for structural and functional studies?

While the search results don't provide specific protocols for S. schwarzengrund Phosphoglycerol transferase I, a methodological approach based on related membrane protein work would include:

Expression Strategy:

  • Amplify the mdoB gene from S. schwarzengrund genomic DNA using specific primers with appropriate restriction sites

  • Clone into an expression vector with an inducible promoter and affinity tag (e.g., His-tag, GST)

  • Transform into an expression host system (E. coli is commonly used)

  • Optimize expression conditions (temperature, inducer concentration, duration)

Purification Protocol:

  • Harvest cells and disrupt by sonication or French press

  • Prepare membrane fractions by differential centrifugation

  • Solubilize the membrane protein using appropriate detergents

  • Perform affinity chromatography using the introduced tag

  • Assess purity by SDS-PAGE and confirm identity by Western blotting or mass spectrometry

Activity Verification:

  • Develop an in vitro assay using arbutin as a model substrate

  • Measure the transfer of phosphoglycerol residues from phosphatidylglycerol

  • Quantify the formation of sn-1,2-diglyceride

These approaches would need to be optimized specifically for S. schwarzengrund Phosphoglycerol transferase I, taking into consideration its membrane-associated nature and potential species-specific characteristics.

What molecular genetic tools are available for studying mdoB in the context of S. schwarzengrund plasmids?

S. schwarzengrund isolates frequently carry various plasmids, with 61.7% of isolates carrying at least one antimicrobial resistance gene . While the search results don't directly connect mdoB to these plasmids, the molecular genetic tools used to study S. schwarzengrund plasmids could be applied to investigate mdoB:

Whole Genome Sequencing Approaches:

  • Short-read sequencing (Illumina) for initial genomic assessment

  • Long-read sequencing (Oxford Nanopore Technology) for complete assembly of complex genetic elements

  • Quality assessment using tools like CheckM

Plasmid Analysis Methods:

  • Plasmid isolation using specialized extraction kits

  • Restriction enzyme mapping

  • SNP-based phylogenetic analysis to determine evolutionary relationships

  • Identification of plasmid types (e.g., IncFIB-IncFIC(FII), IncI1, IncHI2)

Conjugation Experiments:

  • Plate mating or broth mating approaches to study transferability

  • Selection using appropriate resistance markers

  • Verification of transfer using PCR or phenotypic assays

Genetic Manipulation Tools:

  • Lambda Red recombination for chromosomal gene modification

  • CRISPR-Cas9 systems for precise genetic editing

  • Transposon mutagenesis for random insertional inactivation

These tools would be valuable for investigating whether mdoB in S. schwarzengrund is chromosomally encoded (as in E. coli) or if it might be associated with mobile genetic elements in some isolates, potentially contributing to its spread or regulation.

How does Phosphoglycerol transferase I activity affect bacterial membrane composition and properties?

Phosphoglycerol transferase I directly influences membrane-derived oligosaccharide composition by catalyzing the addition of phosphoglycerol residues derived from phosphatidylglycerol. This enzymatic activity creates a link between phospholipid metabolism and periplasmic oligosaccharide modification .

The enzyme's activity affects several aspects of bacterial membrane biology:

In mdoB mutants, the absence of phosphoglycerol residues on MDO is partially compensated by increased ethanolamine content, suggesting interconnected regulatory mechanisms for maintaining appropriate MDO properties .

What is the relationship between Phosphoglycerol transferase I activity and antimicrobial resistance in Salmonella?

While the search results don't directly connect Phosphoglycerol transferase I to antimicrobial resistance mechanisms, several theoretical relationships can be proposed based on the enzyme's function:

  • Membrane Permeability: Alterations in MDO composition could affect the permeability of the bacterial envelope to antimicrobials, particularly those that must traverse the periplasmic space to reach their targets.

  • Envelope Stress Responses: Changes in MDO structure might influence bacterial stress response pathways that are activated by antimicrobials targeting cell envelope integrity.

  • Interaction with Resistance Mechanisms: MDO modifications could potentially interact with other resistance mechanisms, such as efflux pumps or outer membrane protein alterations.

In S. schwarzengrund specifically, studies have shown that 61.7% of isolates carry at least one antimicrobial resistance gene, with common resistance genes including aph(3'')-Ib (aminoglycoside resistance; 47.1%), tet(A) (tetracycline resistance; 9.2%), and sul2 (sulfonamide resistance; 7.3%) . The potential relationship between these resistance mechanisms and membrane-derived oligosaccharide biosynthesis warrants investigation.

How does the function of Phosphoglycerol transferase I in S. schwarzengrund compare to its role in other enteric bacteria?

Comparative aspects to consider include:

CharacteristicE. coliS. schwarzengrundResearch Implications
Genetic locationChromosomal (99.2 min)Not specified in search resultsInvestigate chromosomal location or potential association with mobile elements
Enzyme regulationOsmoregulatedNot specified in search resultsCompare regulatory mechanisms across species
MDO compositionContains phosphoglycerol, phosphoethanolamine, succinateNot specified in search resultsExamine species-specific MDO composition
Physiological impactMembrane homeostasisPotential role in virulence and AMRInvestigate species-specific functions

S. schwarzengrund's identity as a foodborne pathogen with increasing antimicrobial resistance suggests potential specializations in membrane biology compared to commensal E. coli. Comparative studies examining Phosphoglycerol transferase I across different Enterobacteriaceae could reveal how this enzyme has evolved to support diverse bacterial lifestyles .

How might Phosphoglycerol transferase I activity influence S. schwarzengrund virulence and host-pathogen interactions?

While the search results don't directly link Phosphoglycerol transferase I to S. schwarzengrund virulence, we can propose several mechanisms by which it might influence pathogenicity:

  • Cell Surface Properties: Modifications to MDO could alter bacterial surface properties, affecting interactions with host cells and immune components.

  • Adaptation to Host Environments: The osmoregulated nature of MDO biosynthesis suggests a role in adaptation to changing environments encountered during infection .

  • Stress Tolerance: Proper MDO modification might contribute to bacterial survival under various stresses encountered in the host.

  • Interaction with Virulence Factors: MDO modifications could potentially influence the function or expression of virulence factors.

What experimental models are appropriate for studying the role of mdoB in S. schwarzengrund pathogenesis?

To investigate the potential role of mdoB in S. schwarzengrund pathogenesis, researchers could employ several experimental models:

In vitro models:

  • Cell invasion assays: Comparing wild-type and mdoB mutant strains in their ability to invade human epithelial cell lines like Caco-2 .

  • Persistence assays: Evaluating bacterial survival within host cells over time.

  • Biofilm formation: Assessing the impact of MDO modifications on biofilm development.

  • Stress tolerance tests: Measuring bacterial survival under conditions mimicking host environments (acid stress, oxidative stress, antimicrobial peptides).

In vivo models:

  • Animal infection models: Using appropriate animal models to compare colonization, dissemination, and disease progression between wild-type and mdoB mutant strains.

  • Competition assays: Co-infecting with wild-type and mutant strains to directly compare fitness within the host.

  • Immune response studies: Evaluating host immune responses to wild-type versus mdoB mutant infections.

Genetic approaches:

  • Complementation studies: Restoring mdoB function in mutants to confirm phenotypic effects.

  • Reporter fusions: Creating transcriptional or translational fusions to monitor mdoB expression during infection.

  • Transposon mutagenesis: Identifying genes that interact with mdoB in pathogenesis.

These approaches would help elucidate the specific contribution of Phosphoglycerol transferase I to S. schwarzengrund virulence and host interaction.

How does membrane-derived oligosaccharide modification relate to plasmid-encoded virulence factors in S. schwarzengrund?

The search results indicate that S. schwarzengrund isolates frequently carry various plasmids, with approximately 51.5% carrying multiple transfer genes associated with IncFIB-FIC plasmids . While specific connections between these plasmids and membrane-derived oligosaccharide modification aren't directly addressed, several potential relationships can be proposed:

  • Co-regulation: Plasmid-encoded factors and chromosomal genes involved in MDO biosynthesis might be subject to common regulatory mechanisms.

  • Functional Interactions: MDO modifications could create an optimal environment for the function of certain plasmid-encoded virulence factors.

  • Evolutionary Selection: Specific MDO modifications might enhance the fitness advantage conferred by certain plasmids.

Research has shown that IncFIB-IncFIC(FII) fusion plasmids from S. schwarzengrund are self-conjugative and can transfer into E. coli, suggesting mobilization potential . While these plasmids don't significantly enhance invasion and persistence in human Caco-2 cells, their widespread presence in both food and clinical isolates suggests they may confer advantages in other contexts .

The relationship between chromosomal genes like mdoB and plasmid-encoded factors represents an important area for future research, potentially revealing new insights into S. schwarzengrund pathogenesis and evolution.

What bioinformatic approaches can reveal the evolution of mdoB across Salmonella serovars and related Enterobacteriaceae?

Several bioinformatic approaches can be employed to study the evolution of mdoB:

Sequence Analysis:

  • Multiple sequence alignment of mdoB genes across Salmonella serovars and other Enterobacteriaceae

  • Calculation of sequence conservation and diversity metrics

  • Identification of conserved domains and variable regions

  • Determination of selection pressures using dN/dS ratio analysis

Phylogenetic Analysis:

  • Construction of mdoB-based phylogenetic trees

  • Comparison with species phylogeny to detect potential horizontal gene transfer events

  • Analysis of coevolution with other genes involved in MDO biosynthesis

Structural Prediction:

  • Homology modeling of Phosphoglycerol transferase I across species

  • Identification of structurally and functionally important residues

  • Prediction of species-specific structural features

Genomic Context Analysis:

  • Examination of genomic organization around mdoB

  • Identification of regulatory elements and their conservation

  • Detection of mobile genetic elements that might influence mdoB transfer or expression

These approaches would provide insights into how Phosphoglycerol transferase I has evolved in response to different ecological niches and selective pressures across Enterobacteriaceae, potentially revealing adaptive features specific to pathogenic lineages like S. schwarzengrund.

How can high-throughput screening approaches be developed to identify inhibitors of Phosphoglycerol transferase I?

Developing inhibitors of Phosphoglycerol transferase I requires systematic high-throughput screening approaches:

Assay Development:

  • Establish a robust biochemical assay measuring phosphoglycerol transfer from phosphatidylglycerol to arbutin or other suitable substrates

  • Adapt the assay to microplate format for high-throughput screening

  • Implement appropriate controls and validation steps

  • Develop secondary assays to confirm hits and eliminate false positives

Compound Libraries:

  • Natural product collections

  • Synthetic small molecule libraries

  • Fragment-based approaches

  • In silico predicted compounds based on enzyme structure

Screening Workflow:

  • Primary screen to identify compounds inhibiting enzyme activity

  • Dose-response studies with promising candidates

  • Secondary assays to confirm mechanism of action

  • Evaluation of specificity against related enzymes

  • Assessment of activity in bacterial cultures

Lead Optimization:

  • Structure-activity relationship studies

  • Pharmacokinetic and toxicity evaluation

  • Efficacy testing in appropriate infection models

Given the emergence of antimicrobial resistance in S. schwarzengrund , novel targets like Phosphoglycerol transferase I could provide alternative approaches for controlling infections, especially if inhibitors can be developed that specifically target pathogenic species while sparing beneficial bacteria.

What are the potential applications of recombinant Phosphoglycerol transferase I beyond basic research?

Recombinant Phosphoglycerol transferase I has several potential applications beyond fundamental research:

Antimicrobial Development:

  • Target for novel antimicrobial agents, particularly against resistant S. schwarzengrund strains

  • Development of adjuvants that could enhance the efficacy of existing antimicrobials

  • Creation of screening tools for discovering natural products with activity against membrane biosynthesis

Biotechnology Applications:

  • Engineering bacterial membranes with modified properties for biotechnological purposes

  • Development of bacterial strains with enhanced stress tolerance or production capabilities

  • Creation of delivery systems using modified MDOs for vaccines or therapeutics

Diagnostic Tools:

  • Development of assays to detect specific bacterial species based on MDO composition

  • Creation of diagnostic tools for tracking particular bacterial lineages

  • Biomarkers for antimicrobial resistance phenotypes

Fundamental Biology:

  • Understanding membrane biogenesis and homeostasis mechanisms

  • Elucidating osmoregulation pathways in bacteria

  • Investigating links between membrane composition and bacterial pathogenesis

These applications could leverage our understanding of Phosphoglycerol transferase I to address practical challenges in medicine, biotechnology, and diagnostics.

What are the critical parameters to consider when designing gene knockout and complementation studies for mdoB in S. schwarzengrund?

Successful gene knockout and complementation studies for mdoB require careful consideration of several parameters:

Knockout Strategy:

  • Selection of an appropriate method (lambda Red recombination, CRISPR-Cas9)

  • Design of targeting constructs with sufficient homology regions

  • Inclusion of selectable markers that don't interfere with downstream analyses

  • Verification of clean deletion without polar effects on adjacent genes

Complementation Approach:

  • Choice of vector (low-copy vs. high-copy; integration vs. episomal)

  • Selection of promoter (native vs. inducible)

  • Inclusion of the complete gene with necessary regulatory regions

  • Verification of expression levels comparable to wild-type

Controls and Validation:

  • Multiple independent knockout and complementation clones

  • Whole-genome sequencing to confirm genetic background

  • Transcriptomic analysis to verify absence of unintended effects

  • Biochemical assays to confirm loss and restoration of Phosphoglycerol transferase I activity

Phenotypic Characterization:

  • Growth curves under various conditions (osmotic stress, arbutin exposure)

  • MDO isolation and compositional analysis

  • Membrane property assessments

  • Virulence-related phenotypes (invasion, persistence, stress tolerance)

These considerations ensure that phenotypes can be confidently attributed to mdoB function rather than secondary genetic effects or experimental artifacts.

How can advanced mass spectrometry techniques be applied to study MDO modifications in S. schwarzengrund?

Mass spectrometry offers powerful approaches for analyzing MDO modifications in S. schwarzengrund:

Sample Preparation:

  • Isolation of MDOs from bacterial cultures using optimized extraction protocols

  • Enzymatic or chemical treatments to release specific modifications

  • Fractionation methods to separate MDO species of different sizes or compositions

  • Derivatization approaches to enhance ionization or fragmentation

Analytical Techniques:

  • MALDI-TOF MS for rapid profiling of MDO compositions

  • LC-MS/MS for detailed structural characterization

  • Ion mobility MS for separating isomeric structures

  • High-resolution MS for accurate mass determination of modifications

Data Analysis:

  • Targeted approaches for known modifications (phosphoglycerol, ethanolamine, succinate)

  • Untargeted metabolomics to discover novel modifications

  • Comparative analysis between wild-type and mutant strains

  • Quantitative approaches to measure modification stoichiometry

Applications:

  • Characterization of MDO modifications in wild-type S. schwarzengrund

  • Comparison with E. coli and other Enterobacteriaceae

  • Analysis of changes in mdoB mutants

  • Monitoring adaptation to environmental conditions

These advanced analytical approaches would provide unprecedented insights into the structure and dynamics of MDO modifications in S. schwarzengrund, potentially revealing species-specific features related to its pathogenicity or antimicrobial resistance.

What considerations are important when comparing phosphoglycerol transferase activity across different bacterial species?

When comparing phosphoglycerol transferase activity across bacterial species, several important considerations ensure valid and meaningful comparisons:

Enzyme Source:

  • Use of native vs. recombinant enzyme

  • Expression system and purification approach

  • Tag presence and position

  • Storage conditions and stability

Assay Conditions:

  • Buffer composition and pH

  • Temperature and incubation time

  • Substrate source and presentation

  • Detection method sensitivity and specificity

Kinetic Parameters:

  • Determination of Km and Vmax under standardized conditions

  • Effect of potential activators or inhibitors

  • Substrate specificity profiles

  • Influence of membrane environment

Comparative Framework:

  • Inclusion of appropriate positive and negative controls

  • Normalization methods for cross-species comparison

  • Consideration of evolutionary relationships

  • Statistical approaches for significance assessment

ParameterE. coliS. schwarzengrundOther Enterobacteriaceae
Substrate preferenceArbutin, MDO To be determinedSpecies-specific variations
Cofactor requirementsNot specified in search resultsTo be determinedMay vary across species
pH optimumNot specified in search resultsTo be determinedImportant for environmental adaptation
Temperature stabilityNot specified in search resultsTo be determinedMay reflect ecological niche

These considerations ensure that observed differences in enzyme activity reflect true biological variations rather than methodological artifacts, providing insights into species-specific adaptations of phosphoglycerol transferase function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.