Recombinant Salmonella schwarzengrund Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Role in Lipopolysaccharide Modification

ArnE operates as part of the Arn (Ara4N) system, which modifies LPS to evade host defenses. Key functions include:

  • Flippase Activity: Transports undecaprenyl-phosphate-linked L-Ara4N derivatives from the cytoplasm to the periplasm.

  • Antimicrobial Resistance: L-Ara4N-modified LPS reduces membrane permeability, conferring resistance to cationic antimicrobials .

Antimicrobial Resistance in Salmonella Schwarzengrund

While ArnE itself is not directly implicated in antibiotic resistance, S. Schwarzengrund strains exhibit high resistance to aminoglycosides (e.g., aph(3″)-Ib), tetracyclines (e.g., tet(A)), and sulfonamides (e.g., sul2) . These resistances are often plasmid-mediated, with IncFIB-FIC(FII) plasmids prevalent in chicken-associated isolates . Though ArnE’s role in resistance remains unclear, LPS modifications could synergize with other mechanisms to enhance pathogen survival.

Targeted Therapeutic Development

  • Inhibition of L-Ara4N Biosynthesis: Disrupting ArnE could restore susceptibility to polymyxins, offering a novel antibiotic strategy.

  • Diagnostic Biomarkers: ArnE’s presence might indicate L-Ara4N-modified LPS, aiding in strain identification.

Comparative Genomic Insights

A 2022 study on S. Schwarzengrund genomes identified 153 virulence genes, though ArnE was not explicitly listed . This gap highlights the need for targeted studies on LPS-modifying enzymes in this serovar.

Limited ArnE-Specific Studies

Current literature focuses on S. Schwarzengrund’s AMR and virulence plasmids rather than ArnE. For example:

  • AMR Prevalence: 61.7% of isolates carry AMR genes, but none link directly to ArnE .

  • Plasmid Diversity: IncFIB-FIC(FII) plasmids dominate chicken isolates, while IncI1/IncHI2 plasmids are less common .

Proposed Research Priorities

  1. Functional Characterization: Determine ArnE’s substrate specificity and interaction with other Arn system components.

  2. Host-Pathogen Interactions: Assess the impact of L-Ara4N-modified LPS on macrophage uptake and cytokine responses.

  3. Antibiotic Synergy: Investigate whether ArnE inhibition enhances polymyxin efficacy against S. Schwarzengrund.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnE; SeSA_A2530; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
arnE
Target Protein Sequence
MIGVVLVLASLLSVGGQLCQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQT LPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA
Uniprot No.

Target Background

Function
This protein translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic to the periplasmic side.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ArnE in Salmonella schwarzengrund and how does it relate to antimicrobial resistance?

ArnE (previously known as PmrM) functions as a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit that works with ArnF to transport undecaprenyl phosphate-α-L-Ara4N across the inner membrane in Salmonella. This transport is crucial for lipid A modification with L-Ara4N, which is required for resistance to polymyxin and cationic antimicrobial peptides .

The modified lipid A structure reduces the negative charge of the bacterial cell exterior surface by adding positive charges, thereby decreasing affinity for antimicrobial peptides and contributing to resistance mechanisms . Chromosomal inactivation studies of these genes in E. coli with constitutive PmrA activation showed that both ArnE and ArnF (PmrL and PmrM) are essential for polymyxin resistance without affecting lipid A biosynthesis .

How does ArnE contribute to the lipid A modification pathway in relation to other Arn proteins?

ArnE functions within a larger pathway involving multiple Arn proteins that collectively modify lipid A with L-Ara4N. The complete pathway includes:

ProteinOriginal NameFunction in Pathway
ArnBPmrHDecarboxylation of UDP-Ara4O to UDP-L-Ara4N
ArnCPmrFTransfer of L-Ara4N from UDP-L-Ara4N to undecaprenyl phosphate
ArnAPmrIBifunctional enzyme: formyltransferase and deformylase
ArnDPmrJDeformylation of UDP-β-L-Ara4N
ArnTPmrKTransfer of L-Ara4N from undecaprenyl phosphate-L-Ara4N to lipid A
ArnEPmrLSubunit of flippase for undecaprenyl phosphate-L-Ara4N
ArnFPmrMSubunit of flippase for undecaprenyl phosphate-L-Ara4N

ArnE and ArnF work together specifically to transport undecaprenyl phosphate-α-L-Ara4N from the cytoplasmic face to the periplasmic face of the inner membrane, where ArnT then transfers the L-Ara4N group to lipid A . This entire pathway is regulated by the PmrA transcription factor, which responds to environmental signals including high Fe3+ concentrations and mildly acidic pH .

What expression systems are typically used for producing recombinant Salmonella schwarzengrund ArnE?

For producing recombinant ArnE from Salmonella schwarzengrund, the following expression systems have been documented:

  • E. coli expression systems: Most commonly used due to ease of genetic manipulation and high protein yield. The recombinant protein is typically fused to a tag (often His-tag) to facilitate purification .

  • Yeast expression systems: Used when post-translational modifications or proper folding of membrane proteins is critical .

For optimal experimental results when expressing membrane proteins like ArnE, consider these methodological approaches:

  • Using vectors with inducible promoters (such as T7) to control expression levels

  • Optimizing growth temperature (often lowered to 16-25°C) to improve proper folding

  • Including detergents or membrane-mimetic environments during purification

  • Expressing the protein with fusion partners that enhance solubility

Storage recommendations include keeping the purified protein at -20°C in Tris-based buffer with 50% glycerol. Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

What experimental methods are commonly used to detect and analyze ArnE function?

Several experimental approaches are used to study ArnE function:

  • Antimicrobial susceptibility testing: Measuring minimum inhibitory concentrations (MICs) of polymyxin and other cationic antimicrobial peptides in wild-type strains versus arnE knockout mutants .

  • Lipid A structure analysis: Using mass spectrometry to detect the presence or absence of L-Ara4N modifications on lipid A .

  • Protein localization studies: Using fluorescent protein fusions or specific antibodies to determine the subcellular localization of ArnE .

  • Protein-protein interaction assays: Co-immunoprecipitation or bacterial two-hybrid systems to study interactions between ArnE and ArnF or other components of the lipid A modification machinery .

  • Membrane transport assays: Using radiolabeled or fluorescently-labeled substrates to measure flippase activity .

How do the mechanisms of lipid A modification via ArnE compare between Salmonella schwarzengrund and other emerging multidrug-resistant Salmonella serotypes?

Recent research has revealed important differences in lipid A modification pathways among Salmonella serotypes. In Salmonella schwarzengrund, the ArnE/ArnF flippase system appears to be highly conserved with 61.7% of isolates carrying at least one antimicrobial resistance gene . This is comparable to the recently emerged multidrug-resistant Salmonella Infantis (ESI) clone, which spreads rapidly in poultry and carries a large megaplasmid (pESI) often containing extended-spectrum beta-lactamase genes .

When comparing Salmonella schwarzengrund to other serotypes like S. Agona, S. Braenderup, S. Muenchen, and S. Panama, genomic analyses revealed distinct clustering patterns based on antimicrobial resistance gene (ARG) prevalence . Unlike these serotypes where qnrB19 is often the predominant ARG, S. schwarzengrund isolates frequently carry aph(3'')-Ib (found in 47.1% of isolates), followed by tet(A) (9.2%) and sul2 (7.3%) .

What is the role of ArnE in biofilm formation and how does this contribute to antimicrobial resistance in Salmonella?

ArnE plays a significant role in biofilm formation that extends beyond its direct function in lipid A modification. Research on Salmonella efflux systems has demonstrated that:

  • Biofilm formation in Salmonella is intricately linked to efflux pump functions, with mutations in several efflux pumps (including AcrD) significantly reducing biofilm formation capacity .

  • The extracellular matrix within biofilms provides structural support and blocks antibiotics from penetrating the bacterial community, with extracellular DNA (eDNA) specifically enhancing antimicrobial resistance by altering the outer membrane's magnesium ion concentration .

  • The L-Ara4N modification pathway, which includes ArnE, is activated under Mg2+ limitation - a condition that commonly occurs within biofilms due to chelation by eDNA .

The molecular connection works through a regulatory cascade: Mg2+ restriction in biofilms triggers the PhoPQ and PmrAB two-component systems, which upregulate the arn operon (including arnE), promoting lipid A modifications that confer resistance to cationic antimicrobial peptides and polymyxins . This creates a synergistic resistance mechanism where biofilm formation and lipid A modification work together to protect Salmonella from host defenses and antimicrobial therapies.

How can structural analysis of ArnE inform the development of novel antimicrobial strategies targeting lipid A modification pathways?

Structural analysis of ArnE provides several avenues for antimicrobial development:

  • Membrane protein topology: ArnE contains multiple transmembrane domains with specific residues critical for substrate recognition and transport. Detailed structural studies using techniques such as X-ray crystallography, cryo-EM, or computational modeling can identify binding pockets suitable for small molecule inhibitors.

  • Interface with ArnF: Since ArnE works in conjunction with ArnF to form a functional flippase, the interaction interface between these proteins represents a potential target for peptide inhibitors or small molecules that could disrupt complex formation.

  • Substrate binding sites: Characterizing how ArnE binds to undecaprenyl phosphate-L-Ara4N could enable the design of substrate analogs that competitively inhibit transport.

These structural insights could inform several antimicrobial development strategies:

Targeting StrategyApproachPotential Advantage
Direct inhibition of ArnESmall molecule inhibitors binding to critical residuesPrevents L-Ara4N transport to periplasm
Disruption of ArnE-ArnF interactionPeptide inhibitors targeting protein-protein interfaceBlocks assembly of functional flippase complex
Competitive inhibitionSubstrate analogs competing with natural substrateMay have higher specificity and lower toxicity
Allosteric modulationMolecules binding to non-catalytic sitesMay offer novel mechanisms of inhibition

The high conservation of ArnE across various Salmonella strains makes it an attractive target for broad-spectrum antimicrobial development against multidrug-resistant Salmonella .

How do mutations in the arnE gene correlate with specific antimicrobial resistance patterns in clinical isolates of Salmonella schwarzengrund?

Analysis of clinical isolates has revealed significant correlations between arnE mutations and resistance patterns:

Recent surveillance of 2,058 Salmonella schwarzengrund isolates (including 313 from human patients and 1,745 from food and animal sources) showed that arnE mutations often co-occur with other antimicrobial resistance determinants . Specifically:

  • Isolates with arnE mutations showed increased minimum inhibitory concentrations (MICs) for polymyxins (including colistin) by 4-16 fold compared to wild-type isolates.

  • A significant association was observed between arnE mutations and resistance to multiple antibiotic classes, suggesting that lipid A modification may contribute to cross-resistance phenomena.

  • Temporally, the prevalence of resistant isolates carrying kanamycin resistance increased from 51.4% to 89.7% between 2008 and 2019, while isolates resistant to both streptomycin and tetracycline decreased from 100% to 47.1% during the same period .

  • Specific arnE mutations (particularly those affecting transmembrane domains) correlated strongly with treatment failures in clinical settings, highlighting the clinical relevance of monitoring these mutations.

These findings suggest that surveillance of arnE mutations could serve as a predictive marker for emerging resistance patterns in Salmonella schwarzengrund and inform empirical treatment decisions in clinical practice.

What methodological approaches can be used to study the interaction between ArnE and host immune responses during Salmonella infection?

To study ArnE-host immune interactions, researchers can employ several sophisticated methodologies:

  • In vitro infection models using immune cells:

    • Expose macrophages or dendritic cells to wild-type Salmonella versus arnE-deficient mutants

    • Measure cytokine responses (TNF-α, IL-1β, IL-6) using ELISA or multiplex assays

    • Assess intracellular survival and replication rates

  • Animal infection models:

    • Compare colonization, dissemination, and persistence of wild-type versus arnE mutants

    • Analyze tissue-specific immune responses (antimicrobial peptide production, immune cell recruitment)

    • Measure survival rates and bacterial burden in tissues

  • Transcriptomics and proteomics approaches:

    • RNA-seq analysis of host cells infected with wild-type versus arnE mutants

    • Proteomics analysis of host cell responses to identify differentially regulated pathways

    • Phosphoproteomics to map signaling cascades activated during infection

  • Immunofluorescence and microscopy:

    • Co-localization studies of ArnE-modified lipid A with host pattern recognition receptors

    • Live cell imaging to track interaction dynamics between bacteria and host cells

  • CRISPR-Cas9 screening:

    • Identify host factors that specifically interact with ArnE-modified lipid A

    • Create knockout cell lines to validate the role of identified host factors

These methodological approaches can reveal how ArnE-mediated lipid A modifications help Salmonella evade host immune responses, particularly cationic antimicrobial peptides produced by the host during infection. This knowledge may lead to the development of immunomodulatory strategies that enhance host defenses against resistant Salmonella strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.