Recombinant Salmonella schwarzengrund Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella Schwarzengrund Probable Intracellular Septation Protein A (yciB)

Recombinant Salmonella Schwarzengrund Probable Intracellular Septation Protein A (yciB) is a genetically engineered protein expressed in Escherichia coli for research applications. This protein plays a critical role in bacterial cell division and envelope integrity, with homologs studied in Salmonella Dublin and Escherichia coli . The recombinant form typically includes a His tag for purification and is stored in Tris-based buffers with glycerol .

Cell Division and Septation

yciB is implicated in cell envelope biogenesis and septation. In E. coli, YciB interacts with ZipA, a key cell division protein, influencing cell length and septum localization. Deletion of yciB shortens cell length, while overexpression causes elongation .

Envelope Integrity

Synergistic roles with DcrB (a membrane protein) are critical for maintaining cytoplasmic membrane stability. Deficiencies in both proteins lead to membrane vesiculation, peptidoglycan linkage defects, and cell lysis .

Pathogenicity and Virulence

While S. Schwarzengrund yciB itself is not directly linked to virulence, strains carrying plasmids (e.g., IncFIB-IncFIC(FII)) exhibit enhanced survival traits. These plasmids are associated with aerobactin operons (iucABCD, iutA) but do not alter invasion or persistence in host cells .

Comparative Analysis Across Species

FeatureSalmonella Schwarzengrund yciB Salmonella Dublin yciB
Amino Acid Length179 residues179 residues
Expression TagHis tag (type determined during production)N-terminal His tag
Storage Stability6–12 months at -20°C/-80°CSimilar, with glycerol stabilization

Technical Considerations for Use

  • Applications: ELISA, Western blot, protein interaction assays .

  • Buffer Compatibility: Optimized for Tris-based systems; incompatible with reducing agents without validation .

  • Limitations: Sensitivity to repeated freeze-thaw cycles; functional assays require reconstitution verification .

Future Research Directions

  • Mechanistic Studies: Clarify yciB’s role in coordinating septation with envelope biogenesis.

  • Pathogenicity Links: Explore indirect effects of yciB on plasmid-mediated virulence in Salmonella .

  • Structural Biology: Resolve 3D structures to map interaction domains with ZipA and DcrB .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on your location and the purchasing method. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
yciB; SeSA_A1868; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLN LAWALFFIACGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genetic context of yciB in Salmonella schwarzengrund?

The yciB gene in Salmonella schwarzengrund encodes for the probable intracellular septation protein A, which is involved in bacterial cell division processes. Understanding its genetic context requires comparative genomic analysis with other Salmonella serovars. SNP-based phylogenetic analyses, similar to those used for studying plasmid distribution in S. schwarzengrund isolates, can reveal evolutionary relationships and genetic variations in the yciB region . When studying this gene, it's important to analyze its sequence conservation among different isolates, as S. schwarzengrund strains can form distinct lineages based on genetic acquisitions, as demonstrated with plasmid studies .

What cloning strategies are most effective for recombinant expression of yciB from S. schwarzengrund?

For effective cloning of yciB from S. schwarzengrund, researchers should consider the following methodological approach:

  • Primer design: Design specific primers targeting the yciB coding sequence with appropriate restriction sites compatible with your expression vector.

  • PCR amplification: Use high-fidelity polymerase to amplify the target gene from genomic DNA.

  • Cloning vector selection: For membrane-associated proteins like yciB, vectors with fusion tags (His, GST, or MBP) can improve solubility and facilitate purification.

  • Transformation protocol: Similar to techniques used in creating recombinant plasmids for Salmonella detection, transformation conditions should be optimized for your specific construct .

The construction approach can follow similar principles as those used for developing recombinant plasmids in Salmonella detection methods, where standardized reference molecules are created through careful gene region selection and cloning .

How can I verify the expression and localization of recombinant yciB protein?

Verification of recombinant yciB expression and localization requires a multi-faceted approach:

  • Western blotting: Use antibodies against your fusion tag or develop specific antibodies against yciB.

  • Subcellular fractionation: Separate membrane, cytoplasmic, and periplasmic fractions to determine localization.

  • Fluorescence microscopy: Create GFP-fusion constructs to visualize protein localization in live cells.

  • Mass spectrometry: Confirm protein identity and possible post-translational modifications.

The expression verification process should include proper controls and quantification methods, similar to the standardized approaches used in recombinant plasmid-based Salmonella detection systems . When working with membrane proteins like yciB, detergent selection for solubilization becomes critical, as incorrect detergent choice can affect protein folding and function.

What are the optimal growth conditions for S. schwarzengrund cultures for yciB studies?

Optimal growth conditions for S. schwarzengrund for yciB studies include:

  • Media selection: Luria-Bertani (LB) broth is commonly used for culturing Salmonella, as demonstrated in conjugation experiments with S. schwarzengrund .

  • Temperature: Standard incubation at 37°C is appropriate for most experiments.

  • Aeration: Proper aeration through shaking (200-250 rpm) for liquid cultures.

  • Growth phase considerations: For septation protein studies, synchronized cultures may be valuable to capture cell division events.

  • Antibiotic selection: If working with recombinant strains, appropriate antibiotics should be included based on resistance markers .

When studying proteins involved in septation, researchers should consider growth conditions that might alter cell division rates or patterns, such as nutrient limitations or stress conditions, which could affect yciB expression or function.

What purification methods work best for recombinant yciB protein?

Purification of recombinant yciB, which is likely a membrane-associated protein, requires specialized approaches:

  • Membrane extraction: Use gentle detergents (DDM, LDAO, or Triton X-100) to solubilize membrane proteins.

  • Affinity chromatography: Utilize fusion tags (His, GST) for initial purification.

  • Size exclusion chromatography: Remove aggregates and further purify the protein.

  • Stability considerations: Include stabilizing agents like glycerol or specific lipids throughout the purification process.

  • Purity assessment: SDS-PAGE and mass spectrometry to confirm purity and identity.

The purification process must be carefully optimized to maintain protein folding and function, particularly for membrane proteins which are prone to aggregation. Purification steps should be monitored quantitatively with defined acceptance criteria, similar to standardization approaches used in recombinant plasmid-based detection methods .

How does the virulence profile of S. schwarzengrund correlate with yciB expression?

Analysis of the correlation between S. schwarzengrund virulence and yciB expression requires sophisticated experimental approaches:

  • Transcriptomic analysis: RNA-seq or qPCR to measure yciB expression levels under various conditions.

  • Virulence model systems: Cell culture invasion assays (e.g., using Caco-2 cells as described in S. schwarzengrund studies ) to correlate yciB expression with invasion capacity.

  • Comparative analysis: Compare yciB expression between isolates with different virulence profiles, similar to the comparative virulome analyses conducted for S. schwarzengrund isolates .

  • Knockout studies: Generate yciB deletion mutants and assess their virulence potential.

Research shows that S. schwarzengrund isolates from food and clinical sources have similar virulome profiles and invasion abilities in human Caco-2 cells . Investigating whether yciB contributes to these virulence characteristics would require careful experimental design with appropriate controls, including complementation studies to confirm phenotypic changes are specifically due to yciB modification.

What protein-protein interactions does yciB participate in during bacterial cell division?

Investigating yciB protein interactions during cell division requires specialized interaction detection methods:

  • Bacterial two-hybrid systems: Identify direct protein partners of yciB.

  • Co-immunoprecipitation: Pull down protein complexes containing yciB and identify partners via mass spectrometry.

  • Proximity labeling methods: BioID or APEX2 fusions to label proteins in close proximity to yciB in vivo.

  • Fluorescence microscopy: Co-localization studies with other septation proteins using fluorescent tags.

  • Crosslinking mass spectrometry: Identify transient or weak interactions during the dynamic process of cell division.

When analyzing interaction data, researchers should be aware of potential false positives and validate key interactions through multiple independent methods. The interpretation should consider the temporal dynamics of cell division, as interactions may change throughout this process. Comparison of interaction networks between different bacterial species can provide evolutionary insights into conserved septation mechanisms.

How do mutations in yciB affect antimicrobial resistance in S. schwarzengrund?

Investigating the relationship between yciB mutations and antimicrobial resistance requires a systematic approach:

  • Mutation introduction: Site-directed mutagenesis or CRISPR-Cas9 editing to introduce specific mutations.

  • Resistance profiling: Determine minimum inhibitory concentrations (MICs) for various antibiotics in wild-type versus mutant strains.

  • Membrane integrity assays: Assess changes in membrane permeability that might affect antibiotic entry.

  • Gene expression analysis: Examine changes in expression of resistance genes in yciB mutants.

Recent research has shown that plasmid-mediated resistance is significant in S. schwarzengrund, with IncFIB-IncFIC(FII) fusion plasmids conferring streptomycin resistance in both food and clinical isolates . When studying the impact of yciB mutations on resistance, researchers should control for the presence of such plasmids and other resistance determinants that might confound results. Cell division defects caused by yciB mutations could potentially affect growth rates and thus impact apparent resistance levels, requiring careful interpretation of susceptibility testing data.

What is the role of yciB in S. schwarzengrund biofilm formation?

Investigating yciB's role in biofilm formation requires multi-parameter analysis:

  • Static and flow biofilm assays: Compare biofilm formation between wild-type and yciB mutant strains under various conditions.

  • Microscopic analysis: Use confocal microscopy with fluorescent strains to visualize biofilm architecture.

  • Matrix composition analysis: Determine changes in extracellular polymeric substances composition.

  • Gene expression studies: Examine expression of biofilm-related genes in yciB mutants.

  • Competitive assays: Assess fitness of yciB mutants versus wild-type in mixed biofilms.

Biofilm formation is a complex process influenced by many factors, including cell division which is likely affected by yciB function. Researchers should carefully control environmental variables (temperature, media composition, surface properties) when conducting biofilm experiments. The analysis should include quantitative measurements of biomass, viability, and structural parameters to comprehensively characterize the impact of yciB mutations.

How does the structure-function relationship of yciB compare between S. schwarzengrund and other enteric pathogens?

Comparative structure-function analysis of yciB across enteric pathogens requires:

  • Sequence alignment: Identify conserved domains and variable regions across species.

  • Structural prediction: Use computational methods to predict structural features of yciB variants.

  • Complementation studies: Express yciB from different species in S. schwarzengrund yciB mutants to assess functional conservation.

  • Domain swapping: Create chimeric proteins to identify functional domains.

  • Site-directed mutagenesis: Target conserved residues to determine their functional importance.

When interpreting data from such comparative studies, researchers should consider the evolutionary context and selective pressures that may have shaped yciB function in different bacteria. The analysis should incorporate phylogenetic relationships, similar to the SNP-based phylogenetic analyses used for studying S. schwarzengrund isolates . Host adaptation features should be considered, as different pathogens may have evolved specific yciB functions related to their preferred host environments, similar to how certain plasmids in S. schwarzengrund appear to confer adaptive advantages in avian hosts .

What are the best genetic manipulation techniques for studying yciB in S. schwarzengrund?

For effective genetic manipulation of yciB in S. schwarzengrund, researchers should consider:

  • Allelic exchange systems: Two-step recombination processes using suicide vectors for clean deletions or modifications.

  • CRISPR-Cas9 approaches: Newly adapted systems for Salmonella that allow precise genome editing.

  • Transposon mutagenesis: For initial screening of phenotypes related to yciB disruption.

  • Inducible expression systems: To control yciB expression levels for dose-dependent studies.

  • Reporter fusions: Transcriptional and translational fusions to monitor yciB expression patterns.

The choice of technique depends on the specific research question. For example, when studying essential genes like yciB that may be involved in cell division, conditional expression systems are preferable to complete knockouts. When introducing plasmid constructs, researchers should be aware that existing plasmids might affect new plasmid maintenance, as observed in conjugation experiments with S. schwarzengrund .

How can I optimize PCR-based detection of yciB variants across S. schwarzengrund isolates?

For optimized PCR-based detection of yciB variants:

  • Primer design considerations:

    • Target conserved regions flanking variable segments

    • Use degenerate primers to account for potential sequence variations

    • Design primers with similar melting temperatures

    • Check for potential secondary structures and primer-dimer formation

  • PCR optimization strategies:

    • Gradient PCR to determine optimal annealing temperature

    • Touchdown PCR for improved specificity

    • Titration of magnesium concentration

    • Addition of PCR enhancers (DMSO, betaine) for GC-rich regions

  • Validation approach:

    • Sequence verification of amplicons

    • Include positive and negative controls

    • Use reference strains with known yciB sequences

Recent developments in recombinant plasmid-based quantitative Real-Time PCR for Salmonella detection can be adapted for studying yciB variants . Such methods offer advantages including rapid analysis (21h compared to 90h for traditional methods) and high sensitivity (detection limits as low as 10⁰ CFU/ml) . For sequence variants analysis, consider using high-resolution melt curve analysis as a rapid screening tool before sequencing.

How should I design cell culture experiments to study yciB's role in host-pathogen interactions?

When designing cell culture experiments to study yciB's role in host-pathogen interactions:

  • Cell line selection:

    • Caco-2 cells are commonly used for Salmonella studies, as demonstrated in research with S. schwarzengrund

    • Consider multiple cell types to assess tissue specificity

    • Primary cells may provide more physiologically relevant results than immortalized lines

  • Infection protocol considerations:

    • Bacterial growth phase and MOI optimization

    • Synchronization of infection

    • Gentamicin protection assay modifications for invasion vs. persistence studies

  • Readout parameters:

    • Bacterial adhesion, invasion, and intracellular survival quantification

    • Host cell response measurements (cytokine production, cell death markers)

    • Microscopy for localization of bacteria within host cells

  • Controls and comparisons:

    • Wild-type vs. yciB mutant strains

    • Complemented mutants to confirm phenotype specificity

    • Known invasion-defective mutants as reference points

Research with S. schwarzengrund has shown that isolates with different plasmid content may have similar invasion and persistence capabilities in Caco-2 cells . When studying yciB's role, carefully control for other genetic factors that might influence host-pathogen interactions.

What bioinformatic tools should I use to analyze yciB sequence and structural data?

For comprehensive bioinformatic analysis of yciB:

  • Sequence analysis tools:

    • BLAST (Basic Local Alignment Search Tool) for homology identification

    • Clustal Omega or MUSCLE for multiple sequence alignments

    • MEGA or RAxML for phylogenetic analysis

    • SNP analysis pipelines similar to those used in S. schwarzengrund studies

  • Structural prediction resources:

    • AlphaFold or RoseTTAFold for protein structure prediction

    • TMHMM or TOPCONS for transmembrane domain prediction

    • SignalP for signal peptide prediction

    • ProtParam for physicochemical property analysis

  • Functional annotation tools:

    • InterProScan for domain identification

    • ConSurf for evolutionary conservation analysis

    • STRING for protein-protein interaction network prediction

  • Visualization software:

    • PyMOL or Chimera for structural visualization

    • Jalview for sequence alignment visualization

    • iTOL for phylogenetic tree visualization

When analyzing membrane proteins like yciB, pay special attention to hydropathy plots and transmembrane prediction tools. For comparative genomics, the approaches used in SNP-based phylogenetic analyses of S. schwarzengrund isolates provide a good framework .

How can I troubleshoot protein expression issues with recombinant yciB?

When troubleshooting recombinant yciB expression problems:

  • Low expression level issues:

    • Optimize codon usage for expression host

    • Test different promoter strengths

    • Evaluate various induction conditions (temperature, inducer concentration, time)

    • Consider using specialized expression hosts for membrane proteins

  • Protein solubility challenges:

    • Test fusion partners known to enhance solubility (MBP, SUMO, Trx)

    • Optimize lysis conditions with different detergents

    • Explore refolding from inclusion bodies

    • Consider native purification in nanodiscs or amphipols

  • Protein stability problems:

    • Identify optimal buffer conditions through thermal shift assays

    • Add stabilizing agents (glycerol, specific lipids)

    • Use protease inhibitor cocktails during purification

    • Consider auto-induction media for gentler expression

  • Systematic troubleshooting approach:

    • Check protein expression at mRNA level (RT-PCR)

    • Use Western blotting to confirm translation

    • Assess soluble vs. insoluble fractions

    • Evaluate protein quality by size exclusion chromatography

For membrane proteins like yciB, expression and purification strategies require special consideration. The standardized approaches used in developing recombinant plasmid-based systems for Salmonella detection provide useful methodological principles that can be adapted for protein expression troubleshooting .

How should I analyze contradictory results between in vitro and in vivo studies of yciB function?

When faced with contradictory results between in vitro and in vivo yciB studies:

  • Systematic comparison approach:

    • Create a comparison matrix of specific variables and outcomes

    • Identify which aspects are consistent and which differ between systems

    • Evaluate whether differences are quantitative or qualitative

  • Methodological considerations:

    • Assess differences in experimental conditions (temperature, pH, nutrients)

    • Consider host factors present in vivo but absent in vitro

    • Evaluate temporal aspects (acute vs. chronic effects)

    • Analyze dosage or expression level differences

  • Biological interpretation framework:

    • Consider context-dependent protein functions

    • Evaluate compensatory mechanisms present in vivo

    • Assess whether contradictions represent genuine biological complexity

  • Validation strategies:

    • Design hybrid experiments bridging in vitro and in vivo conditions

    • Use ex vivo systems as intermediate models

    • Develop mathematical models to reconcile apparently contradictory data

What statistical approaches are most appropriate for analyzing yciB mutation effects on bacterial phenotypes?

For statistical analysis of yciB mutation effects:

When analyzing complex phenotypes like virulence or host cell invasion, consider multivariate approaches that can account for interactions between multiple factors, similar to the multifactorial analyses used in S. schwarzengrund virulome studies .

How can I integrate transcriptomic, proteomic, and phenotypic data in yciB functional studies?

For integrating multi-omics data in yciB studies:

  • Data preprocessing and normalization:

    • Apply appropriate normalization methods for each data type

    • Handle missing values appropriately

    • Transform data to make datasets comparable

  • Integration strategies:

    • Correlation-based approaches (Pearson, Spearman) to identify relationships

    • Network analysis to visualize relationships between different data types

    • Machine learning methods (PCA, clustering) for pattern identification

    • Pathway and enrichment analysis across multiple data types

  • Validation framework:

    • Cross-validation across datasets

    • Experimental validation of key predictions

    • Comparison with existing knowledge and databases

  • Interpretation approach:

    • Identify convergent evidence across multiple platforms

    • Develop hypotheses for observed divergent results

    • Consider temporal aspects of the various biological processes

Multi-omics integration can help resolve apparent contradictions in data, similar to how virulome and plasmid transfer gene analyses were combined to understand S. schwarzengrund lineages . When interpreting integrated data, consider that different omics approaches may capture different timepoints in biological processes, potentially explaining some discrepancies.

What controls are essential when evaluating yciB involvement in antibiotic resistance mechanisms?

Essential controls for studying yciB's role in antibiotic resistance include:

  • Strain controls:

    • Wild-type parent strain

    • Clean deletion mutant of yciB

    • Complemented mutant with wild-type yciB

    • Complemented mutant with site-directed mutations

    • Empty vector control for complementation

  • Resistance mechanism controls:

    • Strains with known resistance mechanisms

    • Isolates with different plasmid profiles, similar to the characterized S. schwarzengrund strains with IncFIB-IncFIC(FII) fusion plasmids

    • Chemical inhibitors of specific resistance mechanisms

  • Experimental condition controls:

    • Multiple antibiotic concentrations

    • Various growth conditions (media, temperature)

    • Different growth phases

    • Biofilm vs. planktonic conditions

  • Technical controls:

    • Proper standardization of inoculum

    • Inclusion of reference strains with defined MICs

    • Multiple biological and technical replicates

    • Blinding during MIC determination

Research has demonstrated that plasmid-mediated resistance is significant in S. schwarzengrund , so when studying membrane proteins like yciB that might affect antibiotic entry, careful control of other resistance determinants is critical for accurate interpretation.

How should I approach cross-species comparison of yciB function among different Salmonella serovars?

For effective cross-species comparison of yciB function:

  • Systematic sequence analysis approach:

    • Multiple sequence alignment of yciB from different serovars

    • Phylogenetic analysis to establish evolutionary relationships

    • Identification of conserved domains and variable regions

    • SNP analysis similar to approaches used in S. schwarzengrund studies

  • Functional comparison strategy:

    • Standardized phenotypic assays across serovars

    • Heterologous expression experiments

    • Domain swapping between different serovar yciB proteins

    • Identification of serovar-specific interaction partners

  • Experimental design considerations:

    • Use identical experimental conditions for all serovars

    • Include appropriate controls specific to each serovar

    • Account for growth rate differences between serovars

    • Consider host adaptation factors

  • Data normalization approach:

    • Normalize phenotypic data to wild-type levels for each serovar

    • Develop relative indices for cross-serovar comparison

    • Use internal standards for each experiment

  • Interpretation framework:

    • Link functional differences to sequence variations

    • Consider ecological niches of different serovars

    • Evaluate evolutionary pressures on yciB function

This cross-species approach is conceptually similar to the phylogenetic analysis of S. schwarzengrund isolates that identified subclade formation based on plasmid acquisition , but applied to protein function rather than whole-genome relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.