Recombinant Salmonella schwarzengrund Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Salmonella Schwarzengrund Prolipoprotein Diacylglyceryl Transferase (Lgt) is a genetically engineered enzyme critical for bacterial lipoprotein biosynthesis. Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue in prolipoproteins, a process essential for membrane anchoring and lipoprotein maturation . This enzyme is a validated antibacterial target due to its role in maintaining outer membrane integrity and pathogenicity .

Enzyme Architecture

  • Membrane Topology: Lgt is embedded in the inner membrane via seven transmembrane segments, with its N-terminus facing the periplasm and C-terminus oriented toward the cytoplasm .

  • Conserved Motifs: The Lgt signature motif contains invariant residues (Y26, N146, G154) critical for enzymatic activity. Mutational studies show these residues are indispensable for diacylglyceryl transfer .

Key Residues and Mutational Analysis

ResidueRole in ActivityFunctional Impact of Alanine Substitution
Y26CatalyticComplete loss of activity
N146StructuralComplete loss of activity
G154Substrate bindingComplete loss of activity
R143ElectrostaticReduced activity
E243StabilizationReduced activity

Role in Bacterial Pathogenesis

  • Membrane Integrity: Lgt depletion in E. coli causes outer membrane permeabilization, increasing susceptibility to serum killing and antibiotics like ciprofloxacin and aztreonam .

  • Virulence Attenuation: S. Schwarzengrund strains lacking functional Lgt show reduced survival in host environments, highlighting its role in infection .

Inhibitor Development

  • First-Generation Inhibitors: Macrocyclic compounds (e.g., G2823, G2824) inhibit E. coli Lgt in vitro (IC₅₀ = 0.5–2 µM) and exhibit bactericidal activity against multidrug-resistant Acinetobacter baumannii .

  • Resistance Mechanisms: Unlike downstream lipoprotein pathway inhibitors (e.g., LspA-targeting globomycin), Lgt inhibitors remain effective even in lpp (major outer membrane lipoprotein) deletion strains .

Clinical and Biotechnological Relevance

  • Antimicrobial Target: Lgt’s essentiality and conserved structure across Gram-negative bacteria make it a priority for novel antibiotic development .

  • Diagnostic Use: Recombinant Lgt serves as an antigen for antibody production in serological assays to detect Salmonella infections .

Challenges and Future Directions

  • Structural Studies: Full-length crystal structures of S. Schwarzengrund Lgt are needed to refine inhibitor design.

  • Cross-Species Efficacy: Current inhibitors target E. coli Lgt; optimization for Salmonella-specific activity is underway .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lgt; SeSA_A3166; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFRFAMLFPGSRAEDIALLPSH PQWQPIFDTYGVLPRHPSQLYELALEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
Uniprot No.

Target Background

Function

This recombinant Salmonella schwarzengrund Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.