Recombinant Salmonella schwarzengrund Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; SeSA_A0789; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTH IDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWL FSAAAAR
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is the crcB gene regulated in S. schwarzengrund?

The specific regulation of the crcB gene in Salmonella schwarzengrund has not been fully characterized, but based on research in related bacteria, crcB is often regulated by fluoride-responsive riboswitches. These RNA elements change conformation in response to fluoride binding, which then affects transcription or translation of the downstream gene.

In many bacteria, the gene is repressed under normal conditions and becomes derepressed when fluoride levels rise, allowing the bacteria to express CrcB and efflux excess fluoride . Fluoride riboswitches can show species-specific behavior; the B. thailandensis fluoride riboswitch upregulates expression when supplemented with fluoride, but this gene induction does not translate well to E. coli . This suggests that studying crcB regulation in its native S. schwarzengrund context is important for accurate characterization.

Global regulators like CRP-cAMP might also play a role in modulating crcB expression as part of broader stress responses, as suggested by the differential regulation of small RNAs in Salmonella .

What methods are commonly used to express recombinant S. schwarzengrund CrcB?

For expressing recombinant S. schwarzengrund CrcB, several methodological approaches can be employed:

  • Selection of appropriate expression vector: Vectors containing inducible promoters like T7 (pET system), araBAD (pBAD), or tac promoters are suitable choices. For membrane proteins like CrcB, vectors that allow for controlled, moderate expression are preferable to avoid toxicity or inclusion body formation .

  • Use of fusion tags: A dual His6-maltose binding protein (HisMBP) affinity tag can enhance solubility and promote proper folding. The tag can be removed by tobacco etch virus protease at a designed cleavage site .

  • Optimization of expression conditions: For membrane proteins like CrcB, reduced temperature (15-25°C), lower inducer concentrations, and specialized E. coli strains (like C41/C43 or Lemo21) designed for membrane protein expression can improve yields of correctly folded protein .

  • Selection of detergents: Since CrcB is a membrane protein, its extraction and purification require detergents. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) are often suitable initial choices.

  • Scale-up strategies: After successful small-scale expression trials, the process can be scaled up for larger protein yields using bioreactors with controlled conditions .

These methods need to be empirically optimized for CrcB to achieve maximum yield of functional protein.

How do you purify recombinant S. schwarzengrund CrcB protein?

Purification of recombinant S. schwarzengrund CrcB protein typically follows these methodological steps:

  • Cell lysis and membrane isolation: Since CrcB is a membrane protein, cells are lysed by methods such as sonication, French press, or detergent-based lysis. The membrane fraction is isolated by differential centrifugation.

  • Membrane protein solubilization: The membrane fraction is solubilized using appropriate detergents. For CrcB, mild detergents like DDM, LDAO, or OG are potential candidates. The choice of detergent is critical and may require optimization.

  • Affinity chromatography: If CrcB is expressed with an affinity tag (like His-tag or MBP-tag), the solubilized protein can be purified using the corresponding affinity resin. A dual His6-MBP tag can be particularly effective, with the His-tag facilitating purification and the MBP tag enhancing solubility .

  • Tag removal: If a cleavable tag is used, the tag can be removed using a specific protease (e.g., TEV protease for TEV recognition sites) followed by a second affinity step to separate the cleaved tag from the target protein .

  • Further purification: Size exclusion chromatography (SEC) is often used as a final polishing step to obtain homogeneous protein and assess its oligomeric state.

  • Protein quality assessment: The purified protein's purity is typically assessed by SDS-PAGE, and its structural integrity by techniques such as circular dichroism or limited proteolysis.

Throughout the purification process, it's essential to maintain conditions (detergent concentration, buffer composition, pH, temperature) that preserve the protein's native structure and function.

How can you verify the proper folding and functionality of recombinant CrcB?

Verifying the proper folding and functionality of recombinant S. schwarzengrund CrcB is essential for meaningful structural and functional studies. The following methodological strategies can be employed:

  • Complementation assays: A crcB knockout (ΔcrcB) strain is sensitive to high fluoride concentration. Functional recombinant CrcB should rescue this phenotype when expressed in the knockout strain. For rescue tests, a fluoride concentration of 250 µM that significantly inhibits the growth of the mutant strain can be used .

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Thermal stability assays using differential scanning fluorimetry (DSF)

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Structural integrity assessment:

    • Limited proteolysis to probe for well-folded domains

    • Electron microscopy (negative stain or cryo-EM) to visualize protein particles

    • NMR spectroscopy for smaller membrane proteins or domains

  • Functional assays:

    • Ion flux assays in reconstituted proteoliposomes to directly measure fluoride transport

    • Fluoride binding assays using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST)

    • Patch-clamp electrophysiology if the protein can be incorporated into artificial lipid bilayers

These approaches provide complementary information about different aspects of protein folding and function. A protein that passes multiple tests is more likely to be properly folded and functionally active.

How can gene knockout techniques be used to study CrcB function in S. schwarzengrund?

Gene knockout techniques provide powerful tools for studying CrcB function in S. schwarzengrund. Several methodological approaches can be employed:

  • Homologous recombination-based method (Recombineering):

    • This approach uses bacteriophage λ Red recombination proteins (Gam, Beta, and Exo) to facilitate recombination between short homologous DNA segments .

    • For crcB knockout, PCR primers would be designed with 50 bp homology arms flanking the crcB gene and a selectable marker (e.g., kanamycin resistance gene).

    • The aminoglycoside 3'-phosphotransferase (kan) gene kanR with 50 bp homology arms of crcB on each side can be amplified from the plasmid pKD4 by PCR using appropriate primers .

    • The PCR product would be introduced into cells expressing the λ Red proteins, leading to replacement of crcB with the resistance marker.

  • Verification and phenotypic analysis:

    • PCR and sequencing would confirm successful gene knockout.

    • The crcB knockout strain (ΔcrcB) is sensitive to high fluoride concentration, providing a straightforward phenotypic assay .

    • Complementation studies, where wild-type crcB is reintroduced (e.g., on a plasmid), would confirm that observed phenotypes are specifically due to the absence of crcB.

  • Comparative analyses:

    • Global studies (transcriptomics, proteomics) comparing wild-type and ΔcrcB strains could reveal broader cellular effects of crcB deletion.

    • Antibiotic susceptibility testing of the knockout strain could reveal any role of crcB in antimicrobial resistance.

These approaches would provide valuable insights into the biological role of CrcB in S. schwarzengrund, particularly in relation to fluoride resistance and potentially to broader stress responses or virulence mechanisms.

What are the best approaches for studying the role of CrcB in fluoride resistance?

Several methodological approaches can be employed to investigate the role of CrcB in fluoride resistance in S. schwarzengrund:

  • Gene knockout and complementation studies:

    • Create a crcB knockout strain (ΔcrcB) using recombineering techniques.

    • Confirm increased sensitivity to fluoride in the knockout strain.

    • Complement with wild-type crcB to restore resistance.

    • Complement with mutated versions to identify critical residues .

  • Growth inhibition assays:

    • Determine minimum inhibitory concentrations (MICs) of fluoride for wild-type and ΔcrcB strains.

    • Perform growth curves in the presence of sub-lethal fluoride concentrations.

    • Compare growth rates and lag phases to quantify resistance levels.

    • A fluoride concentration of 250 µM has been shown to significantly inhibit the growth of crcB mutant strains .

  • Fluoride uptake and efflux measurements:

    • Use fluoride-selective electrodes to measure intracellular fluoride concentrations.

    • Compare accumulation or efflux rates between wild-type and ΔcrcB strains.

    • Use radioactive 18F for more sensitive detection if available.

  • Gene expression analysis:

    • Measure crcB expression in response to fluoride exposure using RT-qPCR or transcriptional reporters.

    • Fluoride riboswitches often regulate expression of fluoride resistance genes .

    • Investigate the regulatory elements controlling crcB expression (promoters, riboswitches).

  • Structure-function studies:

    • Introduce point mutations in conserved residues of CrcB.

    • Test mutant proteins for their ability to confer fluoride resistance.

    • Identify critical regions for channel function or regulation.

These approaches provide complementary information about different aspects of CrcB's role in fluoride resistance and can be selected based on specific research questions.

How does CrcB contribute to antimicrobial resistance in S. schwarzengrund?

  • Fluoride resistance: CrcB's primary known function in bacteria is to mediate resistance to fluoride ions by facilitating their efflux from the cell. While fluoride itself is not a conventional antibiotic, antimicrobial resistance mechanisms often involve broad-spectrum efflux pumps that can export multiple substrates.

  • Potential cross-resistance: Some efflux systems that confer resistance to one compound can provide cross-resistance to others. If CrcB interacts with or influences the expression of broader-spectrum efflux systems, it could indirectly contribute to resistance to conventional antibiotics.

  • Stress response integration: Bacterial resistance mechanisms often involve coordinated stress responses. If CrcB plays a role in general stress adaptation, it might indirectly contribute to antibiotic tolerance.

  • Genomic context: S. schwarzengrund strain S16 exhibited resistance to multiple antibiotics, including amikacin, ciprofloxacin, sulfamethoxazole, streptomycin, and tetracycline. Genomic analysis revealed 21 different antibiotic-resistance genes across 46 genomes studied . While CrcB was not specifically mentioned among these resistance genes, it could potentially interact with resistance pathways.

Experimental approaches to investigate CrcB's potential role in antimicrobial resistance might include creating crcB knockout strains and assessing their susceptibility to various antibiotics, or overexpressing CrcB and observing any changes in resistance profiles.

What are the differences in CrcB function between pathogenic and non-pathogenic Salmonella strains?

Methodological approaches to investigate these differences include comparative genomics, heterologous expression experiments, gene replacement studies, and functional assays measuring fluoride resistance or related phenotypes.

How can one study the interaction of CrcB with other proteins in S. schwarzengrund?

Studying protein-protein interactions involving CrcB in S. schwarzengrund requires specialized approaches due to its membrane protein nature. The following methodological strategies can be employed:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged CrcB (e.g., His-tag, FLAG-tag) in S. schwarzengrund.

    • Cross-link if necessary to stabilize transient interactions.

    • Solubilize membranes with mild detergents to preserve protein-protein interactions.

    • Purify CrcB using affinity chromatography, bringing along interacting partners.

    • Identify co-purified proteins by mass spectrometry as described for other membrane proteins .

  • Bacterial two-hybrid systems:

    • Adapt bacterial two-hybrid systems for membrane proteins, such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid).

    • Fuse CrcB and potential interacting proteins to complementary fragments of adenylate cyclase.

    • Interaction brings the fragments together, restoring enzyme activity and activating reporter gene expression.

  • Split-GFP complementation:

    • Fuse CrcB and potential partners to complementary fragments of GFP.

    • Interaction brings the fragments together, reconstituting fluorescent GFP.

    • This approach is suitable for visualizing interactions in their native cellular context.

  • Crosslinking-based approaches:

    • Use chemical crosslinkers or photo-activatable amino acids incorporated into CrcB.

    • Crosslink proteins in close proximity to CrcB.

    • Identify crosslinked partners by mass spectrometry.

  • Genetic interaction screens:

    • Create a crcB knockout strain as described previously.

    • Perform synthetic lethality screens or suppressor screens to identify genes functionally related to crcB.

    • Genetic interactions often reflect physical interactions or pathway relationships.

These approaches can reveal the protein interaction network of CrcB, providing insights into its functional context within S. schwarzengrund cellular processes.

What tags are most suitable for purification of recombinant CrcB while maintaining its native function?

Selecting appropriate tags for purification of recombinant S. schwarzengrund CrcB requires careful consideration of the protein's membrane nature and functional requirements:

  • Polyhistidine tags (His-tag):

    • His6 or His10 tags are commonly used for membrane proteins due to their small size and compatibility with detergent-solubilized proteins.

    • They can be placed at either the N- or C-terminus, depending on which end of CrcB is predicted to be cytoplasmic.

    • A His6 tag can be used as part of a dual-tag strategy .

    • His-tags allow purification using immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins.

  • Maltose-binding protein (MBP):

    • MBP can enhance solubility and promote proper folding.

    • For CrcB, an MBP fusion would be most appropriate at a terminal end that faces the cytoplasm.

    • The dual His6-MBP tag approach combines solubility enhancement with efficient purification .

  • Strep-tag II:

    • This small tag (8 amino acids) has high specificity and can be eluted under gentle conditions.

    • It's often used for membrane proteins where function needs to be preserved.

  • Considerations for tag placement:

    • Terminal placement is preferable to avoid disrupting transmembrane domains.

    • If topology predictions are available, place tags on cytoplasmic regions.

    • Include flexible linkers (e.g., GGGGS repeats) between the tag and CrcB to minimize functional interference.

  • Tag removal:

    • Include a protease cleavage site (e.g., TEV protease site) between the tag and CrcB.

    • "The MBP moiety serves to enhance the solubility and promote the proper folding of its fusion partners, and the polyhistidine tag facilitates its purification to homogeneity."

  • Validation of tagged protein function:

    • Complementation assays in ΔcrcB strains can confirm that the tagged protein retains functionality .

The optimal tag choice may require empirical testing, as the impact on folding and function can vary between different membrane proteins.

What are the optimized conditions for expressing soluble S. schwarzengrund CrcB in E. coli?

Optimizing conditions for expressing soluble S. schwarzengrund CrcB in E. coli is particularly challenging since CrcB is a membrane protein. Based on established principles of membrane protein expression, the following methodological approach can be recommended:

  • Expression strain selection:

    • Use specialized E. coli strains designed for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3).

    • These strains have adaptations that reduce toxicity associated with membrane protein overexpression.

  • Expression vector and fusion tags:

    • Consider a dual His6-MBP tag approach, where MBP enhances solubility and the His-tag facilitates purification .

    • Include a cleavable linker (e.g., TEV protease site) to remove the tags after purification.

    • Consider vectors with tunable expression, such as pBAD (arabinose-inducible) or Lemo21 system (rhamnose-tunable).

  • Growth and induction conditions:

    • Lower temperatures (15-25°C) often enhance proper folding of membrane proteins.

    • Reduce inducer concentration to slow expression rate, which can improve folding.

    • Extended expression times (overnight or longer) at low temperatures can increase yields.

    • Rich media supplemented with glycerol can enhance membrane production.

  • Use of specific additives:

    • Addition of specific lipids to the growth medium can sometimes enhance membrane protein folding.

    • For some membrane proteins, addition of specific substrates or ligands during expression can stabilize the protein.

  • Extraction and solubilization:

    • Carefully select detergents for membrane extraction; mild detergents like DDM, LMNG, or LDAO are often good starting points.

    • Screen multiple detergents in small-scale trials to identify optimal conditions.

  • Quality assessment:

    • Use size exclusion chromatography to verify homogeneity and proper oligomerization.

    • Functional assays, such as fluoride sensitivity rescue, can confirm proper folding .

It's important to note that optimization of membrane protein expression often requires extensive empirical testing of different conditions, and what works for one membrane protein may not work for another, even within the same family.

What in vitro assays can be used to study CrcB activity?

To study the activity of S. schwarzengrund CrcB in vitro, several assays can be developed based on its presumed function as a fluoride channel:

  • Liposome-based fluoride transport assays:

    • Reconstitute purified CrcB into liposomes (artificial membrane vesicles).

    • Load liposomes with a fluoride-sensitive fluorescent dye or probe.

    • Monitor fluorescence changes upon addition of external fluoride to measure transport.

    • Alternatively, use radioactive 18F to directly measure fluoride uptake or efflux.

  • Electrophysiological assays:

    • Incorporate CrcB into planar lipid bilayers or patch-clamped liposomes.

    • Measure ion currents across the membrane in response to voltage changes.

    • Determine channel conductance, ion selectivity, and gating properties.

    • Test the effects of potential inhibitors on channel activity.

  • Fluoride binding assays:

    • Use isothermal titration calorimetry (ITC) to measure direct binding of fluoride to purified CrcB.

    • Apply microscale thermophoresis (MST) to detect fluoride-induced changes in protein mobility.

    • Employ fluorescence-based assays if the protein contains appropriately positioned tryptophan residues whose fluorescence might change upon fluoride binding.

  • Structural changes upon fluoride binding:

    • Monitor conformational changes using circular dichroism (CD) or Fourier-transform infrared spectroscopy (FTIR).

    • Apply hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions of the protein that change conformation upon fluoride binding.

  • Cell-based functional reconstitution:

    • Express CrcB in a heterologous system lacking endogenous fluoride transporters.

    • Measure fluoride uptake or efflux using fluoride-sensitive electrodes or fluorescent indicators.

    • The capacity to rescue fluoride sensitivity in ΔcrcB E. coli provides a functional readout: "Unlike the wild-type strain, the crcB knockout (KO) mutant, E. coli K-12 MG1655 ΔcrcB, is sensitive to high fluoride concentration."

These assays provide complementary information about different aspects of CrcB function and can be selected based on the specific research questions and available resources.

What are the evolutionary relationships of CrcB proteins across Salmonella strains and other bacteria?

The evolutionary relationships of CrcB proteins across Salmonella strains and other bacteria can be studied through several approaches:

This evolutionary analysis would be particularly interesting in the context of pathogenic versus non-pathogenic Salmonella strains and in relation to antimicrobial resistance patterns described for S. schwarzengrund .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.