Recombinant Salmonella schwarzengrund Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Biological Role and Mechanism

GlpG mediates quality control of membrane proteins by cleaving orphan subunits of respiratory complexes (e.g., hydrogenase-2 and formate dehydrogenases) . Key findings include:

  • Substrate Specificity: GlpG selectively processes proteins with destabilized TMDs (e.g., HybA, FdnH) only when they are not incorporated into functional complexes .

  • Catalytic Mechanism: The enzyme undergoes conformational changes upon inhibitor binding, stabilizing the active-site geometry for proteolysis .

  • Metabolic Impact: In E. coli, GlpG deletion reduces persistence in the murine gut, linking its activity to fatty acid metabolism and colonization .

Functional Studies

  • Orphan Protein Degradation:
    GlpG initiates degradation of unpartnered subunits like HybA (hydrogenase-2) and FdnH (formate dehydrogenase N) by cleaving their TMDs. Mutation of conserved proline residues (e.g., P259A in FdnH) renders substrates resistant to proteolysis .

  • Synergy with Other Proteases:
    GlpG collaborates with FtsH and Rhom7 (a homolog in Shigella) to ensure membrane protein homeostasis, particularly under stress conditions like oxidative damage .

Usage Notes:

  • Reconstitution: Dissolve in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Avoid repeated freeze-thaw cycles to maintain activity .

Future Directions

Current research focuses on:

  1. Therapeutic Targeting: Exploiting GlpG’s role in bacterial persistence to develop anti-infectives .

  2. Structural Dynamics: Resolving conformational changes during substrate binding using cryo-EM .

  3. Ecological Impact: Assessing GlpG’s contribution to virulence plasmid stability in Salmonella .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
glpG; SeSA_A3716; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRVELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for Recombinant Salmonella schwarzengrund Rhomboid protease glpG?

The protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week. The protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

For reconstitution, it is recommended to:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Aliquot and store at -20°C/-80°C (default final concentration of glycerol is 50%)

What is the modular structure of rhomboid proteases like glpG?

Rhomboid proteases like glpG exhibit a modular functional architecture that influences their folding pathways and functional landscape. This modular structure contributes to multiple possible folding pathways and the population of near-native states with functional significance .

Key structural features include:

  • Intramembrane helical bundles

  • Topological constraints when folding within a bilayer

  • Distinct folding domains that can fold independently or cooperatively

This modular architecture is evolutionarily significant as it allows the protein to fold efficiently within its native membrane environment .

How does the membrane environment affect the folding mechanism of glpG rhomboid proteases?

The membrane environment significantly influences glpG folding through topological constraints. Research using perfectly funneled structure-based models has revealed two distinct folding scenarios :

Folding EnvironmentTopological ConstraintsFolding PathwaysBacktracking
Detergent MicellesMinimal constraintsMultiple pathways with significant backtrackingPresent - previously folded substructures undergo local unfolding
Lipid BilayerSignificant constraintsMore directed pathwaysAbsent - evolutionarily optimized folding

In detergent micelles, there is a large entropic cost for organizing helical bundles without the constraining influence of a bilayer. This leads to folding pathways that require backtracking, where local unfolding of previously folded substructures is necessary to reach the native state .

Conversely, when folding occurs within a bilayer (the environment in which glpG has evolved to fold), the membrane's constraining effect on topology leads to more efficient folding pathways without backtracking .

What experimental methods are most effective for studying the structure-function relationship of recombinant rhomboid proteases?

For comprehensive structure-function analysis of recombinant rhomboid proteases like Salmonella schwarzengrund glpG, a multi-method approach is recommended:

  • Structural Analysis:

    • X-ray crystallography for atomic-resolution structures

    • Cryo-EM for visualizing membrane-embedded conformations

    • NMR for dynamic structural information in solution

  • Functional Characterization:

    • In vitro protease activity assays with fluorogenic substrates

    • Site-directed mutagenesis coupled with activity measurements

    • Membrane reconstitution systems to assess activity in native-like environments

  • Computational Approaches:

    • Structure-based models to study folding pathways

    • Molecular dynamics simulations to examine conformational changes

    • Free-energy landscape analysis to identify functionally relevant states

When designing experiments, researchers should consider the protein's modular architecture and the significant influence of the membrane environment on both structure and function.

What mechanisms explain the paradoxical acceleration of glpG folding by thermodynamically destabilizing mutations?

The paradoxical observation that thermodynamically destabilizing mutations can accelerate glpG folding in detergent micelles is explained by the phenomenon of backtracking in the folding pathway . This mechanism involves:

  • Backtracking in detergent micelles:

    • Without the constraining influence of a bilayer, the protein must overcome a large entropic cost to organize helical bundles

    • This leads to folding pathways where previously folded substructures must partially unfold (backtrack) to reach the native state

    • Destabilizing mutations can disrupt non-native interactions that cause these kinetic traps

  • Absence of backtracking in bilayers:

    • When folding occurs within a membrane bilayer, the natural environment for glpG, backtracking is largely absent

    • The membrane provides topological constraints that guide folding along more direct pathways

    • This explains why the protein has evolved to fold efficiently in a bilayer environment

This research provides important insights for protein engineering efforts aimed at improving the folding efficiency of membrane proteins outside their native environment.

How should researchers optimize E. coli expression systems for recombinant Salmonella schwarzengrund glpG production?

Optimizing E. coli expression systems for Salmonella schwarzengrund glpG requires careful consideration of several factors:

  • Expression Vector Selection:

    • Use vectors with N-terminal His-tag for efficient purification

    • Consider inducible promoter systems (e.g., T7) for controlled expression

    • Ensure vector compatibility with membrane protein expression

  • Expression Conditions:

    • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding

    • Induction: Use lower inducer concentrations with longer expression times

    • Media: Enriched media formulations to support membrane protein production

  • Extraction and Purification Strategy:

    • Membrane fraction isolation using differential centrifugation

    • Solubilization with appropriate detergents (e.g., DDM, LDAO)

    • IMAC purification leveraging the His-tag, with gradient elution

    • Consider size-exclusion chromatography as a polishing step

  • Quality Control Metrics:

    • SDS-PAGE to confirm >90% purity

    • Western blotting to verify intact N-terminal His-tag

    • Activity assays to confirm functional protein production

Based on available product information, the recombinant protein can be successfully expressed in E. coli with an N-terminal His-tag, yielding full-length protein (1-276aa) with greater than 90% purity as determined by SDS-PAGE .

What are the recommended approaches for comparing functional differences between glpG proteases from different Salmonella strains?

When comparing functional differences between glpG proteases from different Salmonella strains, such as S. schwarzengrund and S. dublin, researchers should implement a systematic comparative analysis:

  • Sequence and Structural Analysis:

    • Perform multiple sequence alignment to identify variant residues

    • Conduct homology modeling to predict structural differences

    • Map variations onto structural models to identify functionally relevant regions

  • Enzymatic Characterization:

    • Determine kinetic parameters (kcat, KM) using identical substrate panels

    • Measure activity across different pH and temperature ranges

    • Assess substrate specificity profiles with diverse peptide libraries

  • Membrane Integration Analysis:

    • Compare topological organization in membrane mimetics

    • Evaluate stability in different detergent/lipid environments

    • Analyze oligomerization tendencies using size-exclusion chromatography

  • Comparative Data Analysis Framework:

ParameterS. schwarzengrund glpGS. dublin glpGFunctional Significance
Sequence identityBaselineCompare to baselineEvolutionary conservation
Catalytic efficiencyMeasure kcat/KMMeasure kcat/KMSubstrate processing efficiency
pH optimumDetermineDetermineEnvironmental adaptation
Temperature stabilityMeasure T50Measure T50Environmental adaptation
Substrate specificityProfileProfileTarget selection differences

This systematic approach enables identification of strain-specific functional adaptations that may relate to pathogenicity or environmental niches.

What strategies can resolve poor solubility issues when working with recombinant glpG proteases?

Poor solubility is a common challenge when working with membrane proteins like glpG proteases. Here are evidence-based strategies to address this issue:

  • Optimizing Buffer Conditions:

    • Screen various detergents (DDM, LDAO, CHAPSO) at concentrations above their CMC

    • Test different pH ranges (typically pH 7-8.5 for glpG)

    • Include glycerol (5-15%) to improve stability

    • Consider adding specific lipids that may stabilize the native conformation

  • Protein Engineering Approaches:

    • Express truncated constructs removing flexible regions

    • Introduce solubility-enhancing point mutations at surface-exposed residues

    • Consider fusion partners specifically designed for membrane proteins

  • Alternative Solubilization Methods:

    • Evaluate nanodiscs or styrene-maleic acid lipid particles (SMALPs)

    • Test amphipols as alternative to conventional detergents

    • Consider bicelles for maintaining a more native-like lipid environment

  • Reconstitution Procedure:

    • For reconstitution, use a step-wise detergent removal approach

    • Consider dialysis with controlled removal of detergent

    • Follow the recommended reconstitution protocol: reconstitute in deionized sterile water (0.1-1.0 mg/mL) and add 5-50% glycerol for storage stability

How can researchers differentiate between functional and structural effects when analyzing glpG mutations?

Differentiating between functional and structural effects of mutations in glpG requires a comprehensive analytical approach:

  • Integrated Structural Analysis:

    • Circular dichroism spectroscopy to assess secondary structure changes

    • Thermal denaturation assays to measure stability differences

    • Limited proteolysis to probe conformational changes

    • Intrinsic fluorescence to monitor tertiary structure perturbations

  • Functional Dissection:

    • Activity assays across multiple substrates to identify specificity changes

    • Dose-response studies with inhibitors to detect binding site alterations

    • Membrane integration analysis using EPR or fluorescence techniques

  • Correlation Analysis Framework:

    • Plot structural stability metrics against activity measurements

    • Categorize mutations based on their effects on folding and function:

Mutation Effect CategoryStructural StabilityEnzymatic ActivityLikely Interpretation
Structure-disruptiveDecreasedDecreasedGlobal folding defect
CatalyticUnchangedDecreasedActive site residue
AllostericSlightly alteredChangedLong-range conformational effect
Substrate-bindingUnchangedChanged substrate specificitySubstrate recognition site
Stability-enhancingIncreasedUnchanged or increasedImproved folding efficiency
  • Folding Pathway Analysis:

    • Assess whether mutations affect backtracking during folding

    • Some thermodynamically destabilizing mutations might accelerate folding in detergent micelles by reducing backtracking

    • Compare folding effects in detergent micelles versus membrane bilayers

This systematic approach allows researchers to clearly distinguish between mutations that primarily affect protein structure versus those that specifically impact function while maintaining structural integrity.

What are promising applications of recombinant glpG proteases in biotechnology and structural biology?

Recombinant Salmonella schwarzengrund glpG proteases offer several promising research applications:

  • Structural Biology Advances:

    • Model systems for studying membrane protein folding mechanisms

    • Platforms for developing improved membrane protein crystallization techniques

    • Templates for computational modeling of intramembrane proteolysis

  • Biotechnology Applications:

    • Engineered proteases with modified substrate specificity

    • Development of novel protease inhibitors as potential antimicrobials

    • Biosensors for detecting specific peptide sequences or membrane environments

  • Comparative Biology:

    • Tools for understanding evolutionary adaptations in different Salmonella strains

    • Models for studying how membrane environments influence protein function

    • Systems for investigating bacterial adaptation mechanisms

  • Methodological Advances:

    • Development of improved membrane protein expression systems

    • Creation of novel membrane mimetics for structural studies

    • Refinement of computational approaches for predicting membrane protein folding

The modular architecture of glpG and its interesting folding properties make it particularly valuable for understanding fundamental principles of membrane protein structure, dynamics, and function .

How might advances in computational modeling enhance our understanding of glpG folding and function?

Recent advances in computational modeling offer significant potential for enhancing our understanding of glpG proteases:

  • Advanced Folding Simulations:

    • Integration of structure-based models with explicit membrane representations

    • Markov state modeling to characterize complex folding landscapes

    • Enhanced sampling techniques to explore rare conformational transitions

    • Machine learning approaches to predict folding pathways from sequence data

  • Functional Dynamics Analysis:

    • Long-timescale molecular dynamics simulations to capture functional motions

    • Catalytic mechanism elucidation through quantum mechanics/molecular mechanics

    • Substrate binding and specificity prediction using molecular docking

    • Identification of allosteric networks through network analysis

  • Future Research Opportunities:

    • Development of models that explicitly account for membrane environmental effects

    • Integration of experimental data with computational predictions to create hybrid models

    • Application of AI-based approaches to predict mutations that modulate folding pathways

    • Computational design of modified glpG proteases with enhanced stability or altered specificity

Particularly promising is the continued development of perfectly funneled structure-based models that can implicitly account for the presence or absence of the membrane environment, allowing more accurate prediction of folding pathways in different experimental contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.