Recombinant Salmonella schwarzengrund Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
mdtI; SeSA_A1584; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
mdtI
Target Protein Sequence
MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA
Uniprot No.

Target Background

Function

Catalyzes the excretion of spermidine.

Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtI protein and what is its primary function in bacteria?

The MdtI protein functions as part of a spermidine excretion complex (MdtJI) in bacteria. This complex belongs to the small multidrug resistance (SMR) family of drug exporters and catalyzes the excretion of spermidine from bacterial cells. The MdtJI complex is particularly important when spermidine levels accumulate to potentially toxic concentrations within the cell. Unlike other polyamine transport systems that function at acidic pH, the MdtJI complex effectively exports spermidine at neutral pH .

Research has demonstrated that both MdtJ and MdtI proteins are required for effective spermidine excretion, as transformation with either gene alone does not significantly increase cell viability in spermidine-rich environments. This synergistic relationship suggests the formation of a functional complex between these two proteins is essential for polyamine homeostasis .

How was the spermidine export function of MdtJI initially discovered?

The spermidine export function of MdtJI was discovered through a systematic screening approach of 33 putative drug exporters in Escherichia coli. Researchers used an E. coli strain (CAG2242) deficient in spermidine acetyltransferase, which made the cells particularly sensitive to spermidine accumulation. When cultured in the presence of 2 mM spermidine, the viability of these cells was reduced to less than 0.1% compared to control conditions .

When these cells were transformed with the mdtJI gene, their viability increased more than 1,000-fold when cultured with 2 mM spermidine. Further experiments revealed decreased intracellular spermidine content and increased extracellular spermidine levels in cells expressing MdtJI, confirming its role in spermidine export. Radiolabeled [14C]spermidine was used to directly measure the export activity, demonstrating significant excretion of accumulated spermidine in cells transformed with pUC mdtJI but not in control cells carrying only the vector .

What structural features are known about the MdtI protein?

The MdtI protein contains several critical amino acid residues that are essential for its spermidine export activity. Site-directed mutagenesis studies have identified five specific residues in MdtI that are involved in the excretion activity of the MdtJI complex: Glu5, Glu19, Asp60, Trp68, and Trp81 .

Similarly, in the partner protein MdtJ, six amino acid residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) have been identified as crucial for function. The presence of multiple charged amino acids (glutamate and aspartate residues) in both proteins suggests they may play a role in substrate recognition or transport coupling, while the aromatic residues (tryptophan and tyrosine) might be involved in substrate binding or protein-protein interactions within the complex .

How does the expression of mdtJI respond to cellular polyamine levels?

Research has demonstrated that mdtJI expression is regulated by intracellular polyamine concentrations. Experimental data indicates that the level of mdtJI mRNA increases in response to elevated spermidine levels, suggesting the existence of a transcriptional regulatory mechanism that senses polyamine concentrations .

This inducible expression pattern represents a feedback mechanism that allows bacteria to adapt to fluctuations in polyamine levels. When spermidine accumulates to potentially toxic levels, increased expression of the MdtJI complex enhances export capacity, thereby preventing cytotoxicity. This regulatory response appears to be specific to spermidine rather than other polyamines, as similar induction was not observed with putrescine or spermine in equivalent concentrations .

A quantitative analysis of this response could be conducted using qRT-PCR to measure mdtJI transcript levels under various spermidine concentrations:

Spermidine Concentration (mM)Relative mdtJI mRNA Expression (fold change)
0 (control)1.0
0.52.3
1.04.7
2.08.2
5.09.1

Note: This table represents a hypothetical dataset based on the principles described in the literature but is not directly extracted from the search results.

What experimental approaches can be used to characterize the spermidine transport activity of recombinant MdtI in heterologous systems?

To characterize the spermidine transport activity of recombinant MdtI in heterologous systems, several complementary approaches can be employed:

  • Cell viability assays: Transform spermidine-sensitive strains (e.g., E. coli deficient in spermidine acetyltransferase) with expression vectors containing mdtI and/or mdtJ genes, then challenge with increasing spermidine concentrations to assess cell viability and growth recovery .

  • Polyamine content analysis: Measure intracellular and extracellular polyamine concentrations using HPLC to quantify changes in spermidine distribution in cells expressing recombinant MdtI compared to control cells .

  • Radioisotope transport assays: Use [14C]-labeled spermidine to directly measure export activity by monitoring the appearance of radioactivity in the extracellular medium over time. This can be performed in intact cells or in membrane vesicles prepared from cells expressing the recombinant proteins .

  • Site-directed mutagenesis: Introduce specific mutations in conserved residues (e.g., Glu5, Glu19, Asp60, Trp68, and Trp81) to identify critical amino acids involved in substrate recognition and transport activity .

  • Protein reconstitution in proteoliposomes: Purify the recombinant MdtI and MdtJ proteins and reconstitute them into artificial lipid vesicles to study their transport properties in a defined environment, free from other cellular components.

What is the relationship between MdtI in Salmonella schwarzengrund and antimicrobial resistance?

The relationship between MdtI in Salmonella schwarzengrund and antimicrobial resistance appears to be complex and potentially indirect. While MdtI primarily functions as a spermidine exporter, it belongs to the small multidrug resistance (SMR) family of transporters, many of which can export various antimicrobial compounds .

In S. schwarzengrund, studies have identified an IncFIB-IncFIC(FII) fusion plasmid that confers streptomycin resistance in multiple isolates from both food and clinical sources. This plasmid was detected in 17 out of 55 S. schwarzengrund isolates examined, with 9 from food sources (primarily poultry meat) and 8 from clinical samples (stool, urine, and gallbladder) .

SNP-based phylogenetic analyses revealed that isolates carrying this fusion plasmid formed a distinct subclade, suggesting that the plasmid was acquired and is now maintained by this lineage. The plasmid appears to be derived from avian pathogenic plasmids and might confer an adaptive advantage to S. schwarzengrund isolates within birds, although it did not significantly enhance their invasion and persistence potential in human Caco-2 cells .

This raises intriguing questions about whether MdtI expression or function might be altered in strains carrying such plasmids, potentially contributing to their fitness or resistance profile through mechanisms such as:

  • Enhanced polyamine homeostasis under stress conditions

  • Altered expression of mdtI in response to antibiotics

  • Potential secondary transport activity for certain antimicrobial compounds

How do the functional properties of MdtI differ between E. coli and Salmonella schwarzengrund?

While both E. coli and Salmonella schwarzengrund possess MdtI proteins that function in spermidine export, there may be species-specific differences in their regulation, substrate specificity, or functional efficiency. The amino acid sequence homology between MdtI proteins from these species would provide insight into conserved functional domains versus potentially divergent regions that might confer species-specific properties .

In E. coli, MdtI has been extensively characterized as part of the MdtJI complex responsible for spermidine excretion at neutral pH. The complex appears to be specifically induced by elevated spermidine levels and plays a crucial role in polyamine homeostasis .

In S. schwarzengrund, MdtI may have additional significance due to this organism's importance as a foodborne pathogen that has been associated with outbreaks linked to poultry and turkey products. S. schwarzengrund has shown an increasing prevalence of antimicrobial resistance, including resistance to nalidixic acid, reduced susceptibility to ciprofloxacin, and the ACSSuT resistance type (resistant to ampicillin, chloramphenicol, streptomycin, sulfamethoxazole, and tetracycline) .

Comparative analysis of the mdtI gene sequence, expression patterns, and functional properties between these species would provide valuable insights into potential adaptations that might contribute to S. schwarzengrund's virulence or resistance profiles.

What methodologies are most effective for producing and purifying functional recombinant MdtI protein?

The production and purification of functional recombinant MdtI protein presents several challenges due to its nature as a membrane protein. Based on established protocols for similar proteins, the following methodologies are recommended:

  • Expression system selection:

    • E. coli BL21(DE3) or C43(DE3) strains are preferred for membrane protein expression

    • Use of vectors with tunable promoters (e.g., T7lac) to control expression levels

    • Inclusion of affinity tags (His6, FLAG, or Strep-tag) at either N- or C-terminus for purification

  • Optimization of expression conditions:

    • Low-temperature induction (16-20°C) to minimize inclusion body formation

    • Induction with low IPTG concentrations (0.1-0.5 mM)

    • Supplementation with specific lipids or membrane-stabilizing agents

  • Membrane protein extraction:

    • Gentle cell lysis using enzymatic methods or French press

    • Selective solubilization using mild detergents (DDM, LMNG, or CHAPS)

    • Optimization of detergent:protein ratio to maintain native structure

  • Purification strategies:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Size exclusion chromatography to separate monomeric from oligomeric forms

    • Validation of protein-detergent complex stability throughout purification

  • Functional validation:

    • Reconstitution into proteoliposomes for transport assays

    • Circular dichroism to confirm proper secondary structure

    • Thermal stability assays to assess protein folding and stability

For co-expression of the complete MdtJI complex, a dual expression system using compatible plasmids or a single plasmid with two expression cassettes can be employed. The purified recombinant protein can then be used for structural studies, binding assays, and in vitro transport measurements to further characterize its functional properties.

How can recombinant MdtI be utilized in studies of bacterial physiology and stress response?

Recombinant MdtI serves as a valuable tool for investigating polyamine homeostasis mechanisms in bacteria, particularly under stress conditions. Polyamines (putrescine, spermidine, and spermine) are essential for normal cell growth, and their intracellular levels are tightly regulated through biosynthesis, degradation, uptake, and excretion processes .

Experimental applications include:

  • Stress response studies: Investigating how bacteria modulate polyamine export via MdtI during various stresses (oxidative, osmotic, pH, antimicrobial exposure)

  • Genetic manipulation: Creating knockout and overexpression strains to assess the physiological impact of altered polyamine export capacity

  • Reporter systems: Developing mdtI promoter-reporter constructs to monitor transcriptional responses to environmental stressors

  • Comparative physiology: Examining species-specific differences in polyamine regulation between non-pathogenic and pathogenic bacteria

  • Metabolomic analysis: Investigating the broader metabolic network affected by altered MdtI expression

Research has shown that overaccumulated spermidine is either metabolized by acetylation via spermidine acetyltransferase or neutralized by increasing L-glycerol 3-phosphate . The MdtJI complex provides an additional mechanism for managing excess spermidine by facilitating its export from the cell, highlighting the importance of multiple, complementary regulatory systems in maintaining polyamine homeostasis.

What is the potential significance of MdtI in Salmonella schwarzengrund pathogenesis?

The potential significance of MdtI in Salmonella schwarzengrund pathogenesis stems from the broader importance of polyamine homeostasis in bacterial virulence and adaptation to host environments. S. schwarzengrund has emerged as an important foodborne pathogen, becoming one of the top five Salmonella serovars isolated from retail meat in the U.S., with notable outbreaks linked to ground turkey and dry pet food .

Polyamines play crucial roles in several aspects of bacterial pathogenesis:

  • Biofilm formation: Polyamines contribute to biofilm development, which enhances persistence in hostile environments

  • Stress resistance: Proper polyamine balance improves bacterial survival under the stresses encountered during infection (oxidative burst, pH changes, antimicrobial peptides)

  • Gene regulation: Polyamines modulate the expression of virulence factors through direct and indirect mechanisms

  • Host-pathogen interactions: Bacterial polyamine metabolism can interfere with host polyamine-dependent processes

  • Adaptation to specific niches: The MdtI-mediated polyamine export may be particularly important in certain host environments where polyamine concentrations fluctuate

What are the key unresolved questions about MdtI structure and function?

Despite the significant progress in understanding MdtI's role in spermidine export, several crucial questions remain unanswered:

  • Structural determinants of substrate specificity: While key amino acid residues have been identified (Glu5, Glu19, Asp60, Trp68, and Trp81), their precise roles in substrate recognition and transport mechanism are not fully understood .

  • Oligomeric structure: The stoichiometry and structural arrangement of the MdtJI complex in the membrane remains to be determined through high-resolution structural studies.

  • Transport mechanism: The energy coupling mechanism, transport kinetics, and potential conformational changes during the transport cycle need further investigation.

  • Regulatory network: The complete transcriptional and post-transcriptional regulatory mechanisms controlling mdtI expression in response to varying polyamine levels remain to be elucidated.

  • Species-specific adaptations: The functional differences in MdtI between commensal and pathogenic bacteria, including potential adaptations in S. schwarzengrund that might contribute to its virulence or host specificity.

Advanced experimental approaches such as cryo-electron microscopy, hydrogen-deuterium exchange mass spectrometry, and molecular dynamics simulations could provide valuable insights into these unresolved aspects of MdtI structure and function.

How might MdtI research contribute to the development of novel antimicrobial strategies?

Research on MdtI and the broader mechanisms of polyamine homeostasis presents several promising avenues for antimicrobial development:

  • Inhibitor development: Design of small molecules that specifically inhibit MdtI function could potentially disrupt polyamine homeostasis, leading to toxic accumulation of spermidine in bacterial cells while sparing host polyamine transporters.

  • Combination therapies: Inhibitors of MdtI could be used in combination with conventional antibiotics to enhance their efficacy, particularly against strains with elevated antimicrobial resistance.

  • Attenuated live vaccines: Engineered strains with modified MdtI function could serve as attenuated live vaccine candidates with reduced virulence but maintained immunogenicity.

  • Diagnostic markers: The presence of specific variants of MdtI or associated plasmids could serve as diagnostic markers for tracking particularly virulent or resistant S. schwarzengrund lineages.

  • Host-directed therapies: Understanding how bacterial polyamine transport systems interact with host polyamine metabolism could lead to host-directed therapeutic approaches that indirectly compromise bacterial fitness.

Given the rising antimicrobial resistance observed in S. schwarzengrund isolates, including resistance to nalidixic acid, reduced susceptibility to ciprofloxacin, and the ACSSuT resistance type , novel therapeutic approaches targeting fundamental physiological processes such as polyamine homeostasis could provide valuable alternatives to conventional antibiotics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.