Recombinant Salmonella schwarzengrund Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is expressed in E. coli systems, followed by affinity chromatography using the His tag . Critical protocols include:

  • Reconstitution: Lyophilized protein is resuspended in sterile water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .

  • Quality Control: Purity confirmed via SDS-PAGE; endotoxin levels meet research-grade standards .

Functional and Mechanistic Insights

MdtJ belongs to the multidrug and toxic compound extrusion (MATE) family, which mediates spermidine export—a process linked to bacterial survival under oxidative stress and antimicrobial resistance . Key findings include:

  • Association with Multidrug Resistance: S. schwarzengrund isolates carrying MdtJ frequently exhibit resistance to aminoglycosides (e.g., streptomycin), sulfonamides, and tetracyclines .

  • Epidemiological Significance: Strains with MdtJ have been implicated in international outbreaks linked to poultry and imported food products .

Comparative Analysis with Homologs

MdtJ orthologs exist across Salmonella serovars, with sequence variations impacting functional specificity. For example:

SerovarUniProt IDKey Sequence Difference
S. schwarzengrundB4TVE8C-terminal residues: PVKGAARATI
S. DublinB5FHS2C-terminal residues: PVKEATRATI

These variations may influence substrate binding or export efficiency .

Research Applications and Implications

  • Antimicrobial Resistance Studies: MdtJ’s role in efflux mechanisms provides insights into resistance gene propagation, particularly in poultry-associated isolates .

  • Structural Biology: The protein’s small size and solubility make it suitable for crystallography or NMR studies to map spermidine-binding domains .

  • Vaccine Development: As a conserved membrane protein, MdtJ is a potential target for novel antimicrobial strategies .

Challenges and Future Directions

  • Functional Redundancy: Co-expression with other efflux pumps (e.g., AcrAB-TolC) complicates mechanistic studies .

  • Clinical Relevance: Further work is needed to establish direct links between MdtJ expression and virulence in human infections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development accordingly.
Synonyms
mdtJ; SeSA_A1583; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKGAARATI
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Spermidine export protein MdtJ and what is its function?

Spermidine export protein MdtJ is a membrane protein that functions as part of a protein complex involved in the excretion of spermidine from bacterial cells. MdtJ belongs to the small multidrug resistance (SMR) family of drug exporters. This protein works in conjunction with MdtI to form the MdtJI complex, which catalyzes the excretion of spermidine from cells. The complex plays a crucial role in regulating intracellular spermidine levels, which is important because excessive accumulation of spermidine can be toxic to bacterial cells. Research has demonstrated that both MdtJ and MdtI are necessary for cells to recover from the toxicity caused by overaccumulated spermidine . The protein functions as a protective mechanism against the potential toxic effects of excessive polyamine accumulation within bacterial cells.

What is the structural composition of Recombinant Salmonella schwarzengrund Spermidine export protein MdtJ?

The Recombinant Salmonella schwarzengrund Spermidine export protein MdtJ is a membrane protein consisting of 120 amino acids. The full amino acid sequence is: MFYWILLALAIATEGTLSMKWASVGNGNAGILMLVMITLSYIFLSFAVKKIALGVAYALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKGAARATI . This protein is characterized by its hydrophobic regions that facilitate its integration into the cell membrane. As a member of the small multidrug resistance (SMR) family, MdtJ typically contains four transmembrane alpha-helical domains that span the cytoplasmic membrane. The specific folding of these domains creates a channel through which spermidine can be transported from the intracellular to the extracellular environment, effectively regulating intracellular polyamine concentrations.

How does the MdtJI complex contribute to bacterial survival mechanisms?

The MdtJI complex serves as a critical component in bacterial survival mechanisms by regulating intracellular spermidine levels. When bacteria face elevated spermidine concentrations, which can become toxic if accumulated excessively, the MdtJI complex provides a protective function by exporting excess spermidine out of the cell. Research has demonstrated that when bacterial cells are exposed to high concentrations of spermidine (2 mM), the expression of mdtJI mRNA increases, indicating a regulatory response to the environmental stimulus . This upregulation corresponds with a decrease in intracellular spermidine content and enhanced excretion of spermidine from cells. The ability to modulate polyamine concentrations through this export system helps bacteria maintain homeostasis and adapt to changing environmental conditions, particularly in environments where polyamine concentrations might fluctuate significantly.

What key amino acid residues are essential for MdtJ function, and how can site-directed mutagenesis be used to elucidate their roles?

Research has identified several critical amino acid residues in MdtJ that are essential for its function in spermidine excretion. Specifically, Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 in MdtJ have been shown to be involved in the excretion activity of the MdtJI complex . Similarly, in MdtI, residues Glu5, Glu19, Asp60, Trp68, and Trp81 are important for function.

To elucidate the specific roles of these residues, site-directed mutagenesis experiments can be designed as follows:

  • Generate a series of point mutations for each identified residue, typically replacing them with alanine or other amino acids with distinct chemical properties

  • Express these mutant proteins in a bacterial system lacking endogenous MdtJ/MdtI (knockout strains)

  • Assay the spermidine excretion activity using methods such as:

    • Measuring intracellular spermidine accumulation using HPLC or LC-MS/MS

    • Conducting growth inhibition assays in the presence of high spermidine concentrations

    • Using radiolabeled spermidine to track export kinetics

This approach allows researchers to determine which residues are involved in substrate binding, protein-protein interactions within the complex, or conformational changes necessary for transport activity. Additionally, computational modeling can complement these experimental approaches by predicting how specific mutations might affect protein structure and function.

How can Design of Experiments (DoE) methodology be applied to optimize expression and purification of recombinant MdtJ protein?

The Design of Experiments (DoE) methodology offers a systematic approach to optimize the expression and purification of recombinant MdtJ protein by simultaneously analyzing multiple variables that affect protein yield and activity. Unlike traditional one-factor-at-a-time (OFAT) approaches, DoE allows researchers to understand interactions between different experimental parameters .

To apply DoE for optimizing MdtJ expression and purification:

  • Define critical factors:

    • Expression system variables: promoter strength, inducer concentration, growth temperature, media composition

    • Purification variables: buffer composition, pH, salt concentration, detergent type/concentration (critical for membrane proteins)

  • Select appropriate DoE design:

    • For initial screening: Plackett-Burman design to identify significant factors from many variables

    • For optimization: Response Surface Methodology (RSM) approaches like Box-Behnken design (BBD) or Central Composite Design (CCD)

  • Execute experiments and analyze results:

    • Measure responses such as protein yield, purity, and functional activity

    • Use statistical software to generate predictive models

  • Validation and implementation:

    • Confirm model predictions with validation experiments

    • Implement optimized conditions for routine production

Table 1: Example DoE Factor Levels for MdtJ Expression Optimization

FactorLow Level (-1)Center Point (0)High Level (+1)
Temperature (°C)253037
IPTG concentration (mM)0.10.51.0
Induction time (hours)4816
Cell density at induction (OD600)0.40.81.2
Media compositionMinimalDefinedRich

This approach is particularly valuable for membrane proteins like MdtJ, which are often challenging to express in functional form due to their hydrophobic nature and requirement for proper membrane integration .

What are the current limitations in studying the kinetics of spermidine transport by the MdtJI complex, and how might these be addressed?

Studying the kinetics of spermidine transport by the MdtJI complex presents several challenges that limit our understanding of its mechanism. Current limitations include:

  • Membrane protein reconstitution challenges:

    • Maintaining the native structure and function of MdtJ and MdtI during extraction from membranes

    • Establishing a suitable lipid environment for reconstitution studies

  • Transport assay limitations:

    • Difficulty in creating consistent artificial membrane systems that mimic natural conditions

    • Challenges in real-time monitoring of spermidine transport across membranes

  • Complex formation dynamics:

    • Understanding the stoichiometry and assembly mechanism of the MdtJI complex

    • Elucidating conformational changes during transport cycles

To address these limitations, researchers could employ the following innovative approaches:

  • Advanced membrane protein techniques:

    • Nanodiscs or lipid cubic phase crystallization for structural studies

    • Single-molecule fluorescence spectroscopy to monitor conformational changes

  • Novel transport assays:

    • Development of fluorescent spermidine analogs for real-time transport tracking

    • Creation of MdtJI-containing proteoliposomes with encapsulated fluorescent indicators responsive to spermidine

  • Computational approaches:

    • Molecular dynamics simulations to model transport mechanisms

    • Machine learning approaches to predict structure-function relationships based on existing data

  • Genetic engineering strategies:

    • Creation of fluorescently tagged MdtJ and MdtI variants that retain function

    • Development of inducible expression systems for kinetic studies in vivo

By combining these approaches, researchers can develop a more comprehensive understanding of the transport kinetics and mechanism of the MdtJI complex, potentially leading to insights applicable to other polyamine transport systems.

What are the optimal conditions for expressing and purifying functional recombinant MdtJ protein?

Expressing and purifying functional membrane proteins like MdtJ requires careful optimization of conditions to maintain their native structure and function. Based on current research protocols, the following approach is recommended:

Expression System:

  • Host strain selection: E. coli BL21(DE3) or C43(DE3) strains are typically preferred for membrane protein expression due to their tolerance for toxic proteins

  • Vector selection: pET-based vectors with T7 promoter systems offer controllable expression

  • Growth conditions:

    • Temperature: Lower temperatures (16-25°C) during induction reduce inclusion body formation

    • Media: Rich media supplemented with glucose (0.5%) to prevent leaky expression

    • Induction: 0.1-0.5 mM IPTG when culture reaches OD600 of 0.6-0.8

    • Post-induction growth: 12-16 hours at reduced temperature

Purification Protocol:

  • Membrane extraction:

    • Cell lysis via mechanical disruption (e.g., French press or sonication)

    • Differential centrifugation to isolate membrane fractions

    • Solubilization using mild detergents (n-dodecyl-β-D-maltoside or CHAPS at 1-2%)

  • Chromatography steps:

    • Immobilized metal affinity chromatography (IMAC) using His-tag

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Buffer composition: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, 0.05% detergent

  • Quality assessment:

    • SDS-PAGE and Western blotting for purity and identity confirmation

    • Circular dichroism for secondary structure analysis

    • Dynamic light scattering for homogeneity assessment

The final purified protein should be stored in a stabilizing buffer containing 50% glycerol at -20°C for short-term storage or at -80°C for extended storage to preserve functionality . Prior to functional assays, it's advisable to confirm protein integrity using size exclusion chromatography or native PAGE.

How can researchers design experiments to study the interaction between MdtJ and MdtI proteins?

Investigating the interaction between MdtJ and MdtI proteins requires a multifaceted approach combining biochemical, biophysical, and genetic techniques. The following experimental design strategies can help elucidate the nature of these interactions:

  • Co-immunoprecipitation (Co-IP) studies:

    • Express tagged versions of MdtJ and MdtI (His-tag, FLAG-tag, etc.)

    • Perform pull-down assays to confirm physical interaction

    • Use crosslinking agents to stabilize transient interactions

  • Fluorescence Resonance Energy Transfer (FRET):

    • Generate fusion proteins with fluorescent protein pairs (e.g., CFP-MdtJ and YFP-MdtI)

    • Measure FRET efficiency to determine proximity and orientation

    • Perform live-cell imaging to observe interaction dynamics in real-time

  • Bacterial Two-Hybrid (B2H) system:

    • Clone mdtJ and mdtI into B2H vectors

    • Assess interaction strength through reporter gene expression

    • Create truncation or point mutation libraries to map interaction domains

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified MdtJ on sensor chip

    • Flow purified MdtI at various concentrations

    • Determine binding kinetics (kon, koff) and affinity constants (KD)

  • Genetic complementation assays:

    • Create mdtJ and mdtI knockout strains

    • Perform cross-complementation with wild-type and mutant variants

    • Assess spermidine resistance phenotypes

Experimental Controls and Variables:

Experiment TypePositive ControlNegative ControlVariables to Test
Co-IPKnown interacting proteinsUnrelated membrane proteinDetergent type, salt concentration
FRETFusion protein with linkerNon-interacting protein pairDistance between fluorophores
B2HKnown interacting pairsEmpty vectorsFusion orientation, induction level
SPRConcentration seriesUnrelated proteinpH, buffer composition
ComplementationWild-type genesEmpty vectorPoint mutations, truncations

By implementing this comprehensive experimental design, researchers can not only confirm the interaction between MdtJ and MdtI but also characterize the structural and functional aspects of their association in forming the active spermidine export complex .

What techniques are most effective for measuring spermidine export activity mediated by the MdtJI complex?

Measuring spermidine export activity mediated by the MdtJI complex requires sensitive and specific techniques. Based on current research methodologies, the following approaches are recommended:

  • Radiolabeled substrate transport assays:

    • Load cells or membrane vesicles with [14C]- or [3H]-labeled spermidine

    • Measure efflux rates by sampling extracellular medium at various time points

    • Quantify using liquid scintillation counting

    • Advantages: High sensitivity and direct measurement of transport activity

  • HPLC-based quantification:

    • Pre-load cells with spermidine, then measure intracellular and extracellular levels over time

    • Derivatize spermidine with dansyl chloride or o-phthalaldehyde for fluorescence detection

    • Advantages: No radioactive materials required; can simultaneously detect multiple polyamines

  • Fluorescent spermidine analogs:

    • Synthesize fluorescent spermidine derivatives that retain transport properties

    • Monitor transport using fluorescence spectroscopy or microscopy

    • Advantages: Potential for real-time monitoring and spatial resolution

  • Indirect growth-based assays:

    • Utilize strains sensitive to spermidine toxicity (e.g., spermidine acetyltransferase-deficient strains)

    • Compare growth rates in the presence of exogenous spermidine

    • Measure growth curves with or without expression of MdtJI

    • Advantages: Simple setup, suitable for high-throughput screening

  • Electrophysiological measurements:

    • Reconstitute purified MdtJI complex in planar lipid bilayers

    • Measure current changes upon addition of spermidine

    • Advantages: Direct measurement of transport kinetics and mechanism

Table 2: Comparison of Spermidine Export Measurement Techniques

TechniqueSensitivityThroughputIn vivo/In vitroSpecial EquipmentLimitations
Radiolabeled assaysVery highMediumBothScintillation counterSafety concerns, disposal issues
HPLC quantificationHighLow-MediumBothHPLC systemTime-consuming, requires sample processing
Fluorescent analogsMedium-HighHighBothFluorometer/microscopePotential alteration of substrate properties
Growth-based assaysLow-MediumVery highIn vivo onlyPlate readerIndirect measurement, influenced by other factors
ElectrophysiologyVery highVery lowIn vitro onlyPatch-clamp equipmentTechnical complexity, artificial environment

Research has shown that combining multiple techniques provides the most comprehensive understanding of spermidine export activity. For instance, combining growth-based screening with direct transport measurements allows for both high-throughput identification of functional variants and detailed characterization of transport kinetics .

How should researchers interpret contradictory results between in vivo and in vitro studies of MdtJ function?

When researchers encounter contradictory results between in vivo and in vitro studies of MdtJ function, a systematic approach to interpretation is essential. Several factors may contribute to these discrepancies:

  • Environmental differences:

    • In vivo: Complex cellular environment with multiple interacting systems

    • In vitro: Simplified system lacking cellular components that may influence function

  • Protein conformation and stability:

    • Membrane proteins like MdtJ are particularly sensitive to their lipid environment

    • Detergent solubilization for in vitro studies may alter native structure

  • Complex formation considerations:

    • In vivo: Natural stoichiometry and assembly of the MdtJI complex

    • In vitro: Potential difficulties reconstituting the full functional complex

Interpretation Framework:

  • Assess methodological variables:

    • Examine differences in experimental conditions (pH, ionic strength, temperature)

    • Consider the presence/absence of cofactors or interacting proteins

    • Evaluate the influence of expression system (overexpression vs. native levels)

  • Reconciliation strategies:

    • Develop intermediate models that explain both sets of observations

    • Use computational approaches to predict how in vitro conditions might alter function

    • Design hybrid experiments that bridge the gap between systems

  • Validation approaches:

    • Perform structure-function studies using point mutations in both systems

    • Use spectroscopic methods to compare protein conformation in different environments

    • Develop more physiologically relevant in vitro systems (e.g., nanodiscs, proteoliposomes)

When interpreting contradictory results, researchers should remember that discrepancies often reveal important biological insights rather than experimental failures. For example, if MdtJ shows different spermidine export kinetics in vivo versus in vitro, this might indicate the presence of unknown regulatory factors or required protein-protein interactions in the cellular environment. Systematic investigation of these differences can lead to discoveries about the regulatory mechanisms controlling MdtJ function.

What statistical approaches are most appropriate for analyzing MdtJ expression optimization experiments?

  • Design of Experiments (DoE) statistical analysis:

    • Analysis of Variance (ANOVA) to identify significant factors affecting expression

    • Regression analysis to develop predictive models of protein yield

    • Response Surface Methodology (RSM) to visualize optimal conditions

    • Main effects and interaction plots to understand factor relationships

  • Multivariate analysis approaches:

    • Principal Component Analysis (PCA) to reduce dimensionality of complex datasets

    • Partial Least Squares (PLS) regression for modeling when factors are highly correlated

    • Cluster analysis to identify patterns in expression conditions

  • Appropriate tests for specific experimental designs:

    • For factorial designs: factorial ANOVA with post-hoc tests

    • For optimization experiments: polynomial regression models

    • For screening experiments: Pareto analysis of effects

Statistical Analysis Workflow:

  • Data preprocessing:

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Transform data if necessary (log, square root) to meet assumptions

    • Identify and handle outliers appropriately

  • Model building and validation:

    • Start with full models including all factors and interactions

    • Use stepwise regression or information criteria (AIC, BIC) for model selection

    • Validate models through cross-validation or holdout samples

  • Interpretation and visualization:

    • Generate contour plots or 3D response surfaces to visualize optimal conditions

    • Calculate confidence intervals for predictions

    • Perform sensitivity analysis to assess robustness

Table 3: Statistical Methods for Different Experimental Designs in MdtJ Expression Studies

Experimental DesignPrimary Statistical MethodSecondary AnalysisVisualization
Fractional FactorialANOVAEffect size estimationPareto charts, Main effects plots
Central CompositePolynomial regressionCanonical analysisResponse surface plots, Contour plots
Box-BehnkenPolynomial regressionRidge analysisContour plots, Overlay plots
Definitive ScreeningStepwise regressionEffect sparsity analysisPrediction profiler
One-factor-at-a-timet-tests or simple ANOVATrend analysisLine plots with error bars

For MdtJ expression optimization, DoE approaches that can handle both categorical variables (e.g., expression system, buffer type) and continuous variables (e.g., temperature, inducer concentration) are particularly valuable. These methods allow researchers to identify not only the main effects of individual factors but also interactions between factors that might significantly impact expression yield and protein activity .

How can researchers compare the functional characteristics of MdtJ with other members of the small multidrug resistance (SMR) family?

Conducting comprehensive comparative analyses of MdtJ with other SMR family members requires a structured approach that integrates multiple levels of information. The following strategy enables researchers to systematically compare functional characteristics:

  • Sequence-based comparative analysis:

    • Multiple sequence alignment (MSA) of MdtJ with other SMR proteins

    • Phylogenetic analysis to establish evolutionary relationships

    • Identification of conserved motifs and divergent regions

    • Conservation scoring to highlight functionally important residues

  • Structural comparison methods:

    • Homology modeling based on available SMR protein structures

    • Superimposition of structures to identify conformational differences

    • Analysis of substrate binding pockets and transport pathways

    • Electrostatic surface potential comparison

  • Functional characterization comparison:

    • Substrate specificity profiling using consistent methodologies

    • Transport kinetics parameters (Km, Vmax) determination under standardized conditions

    • pH and ion dependence of transport activity

    • Inhibitor sensitivity patterns

  • Experimental validation of predictions:

    • Domain swapping between MdtJ and other SMR proteins

    • Site-directed mutagenesis of predicted functional residues

    • Heterologous expression systems for comparative analysis

Table 4: Comparative Analysis of MdtJ with Selected SMR Family Members

SMR ProteinPrimary SubstrateSecondary SubstratesTransport MechanismKey Functional ResiduesComplex Formation
MdtJSpermidineUnknownMdtJI complexTyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82Heterodimer with MdtI
EmrEQuaternary ammonium compoundsAcriflavine, ethidiumHomodimerGlu14, Tyr40, Tyr60Homodimer
SugEQuaternary ammonium compoundsCetylpyridiniumUnknownTrp63, Phe43, Tyr53Homodimer
QacCQuaternary ammonium compoundsEthidium, proflavineProton antiportGlu13, Tyr59, Tyr63Homodimer
SsmEMethyl viologenEthidiumUnknownGlu14, Tyr40Unknown

This comparative approach allows researchers to:

  • Identify unique features of MdtJ that might explain its specificity for spermidine

  • Discover shared mechanisms among SMR transporters

  • Generate hypotheses about structure-function relationships

  • Design targeted experiments to validate functional predictions

By integrating evolutionary, structural, and functional data, researchers can develop a comprehensive understanding of how MdtJ's characteristics relate to other SMR family members, potentially revealing common principles of transport mechanisms as well as specialized adaptations for polyamine transport .

What are the most promising future research directions for understanding MdtJ function in bacterial physiology?

The study of MdtJ presents numerous opportunities for advancing our understanding of bacterial polyamine transport and its role in cellular physiology. Based on current knowledge and technological capabilities, the following research directions show particular promise:

These research directions will benefit from emerging technologies such as CRISPR-Cas9 genome editing for precise manipulation of endogenous mdtJ genes, advanced imaging techniques for visualizing protein localization and dynamics, and computational approaches for predicting protein-substrate interactions. By pursuing these multidisciplinary approaches, researchers can develop a comprehensive understanding of MdtJ's role in bacterial physiology and potentially identify new strategies for controlling bacterial growth and virulence.

How might knowledge of MdtJ function contribute to broader understanding of membrane transport systems?

The study of MdtJ has the potential to make significant contributions to our broader understanding of membrane transport systems due to several unique aspects of its structure, function, and regulation. These insights may translate to general principles applicable across diverse transport systems:

  • Mechanistic insights:

    • Understanding how the MdtJI heterodimer coordinates spermidine transport could reveal fundamental principles of substrate recognition and translocation

    • The role of specific amino acid residues in creating transport pathways may inform general models of membrane transport

    • Elucidation of conformational changes during the transport cycle could reveal conserved mechanisms across transporter families

  • Complex formation principles:

    • The heteromeric nature of the MdtJI complex provides an excellent model for studying how different subunits contribute to transport function

    • Investigation of the stoichiometry and assembly of the complex may reveal principles applicable to other heteromeric transporters

    • Understanding the structural basis of subunit specificity could inform protein engineering approaches

  • Regulatory mechanisms:

    • Examining how spermidine levels influence mdtJI expression provides insights into substrate-mediated regulation of transporters

    • The integration of MdtJ function with cellular polyamine homeostasis mechanisms illustrates how transport systems are coordinated with metabolic networks

    • Post-translational regulation of MdtJ activity may reveal general principles of transporter regulation

  • Evolutionary perspectives:

    • Comparative analysis of MdtJ across bacterial species can illuminate evolutionary pressures on membrane transporters

    • Understanding how substrate specificity evolved in the SMR family may provide insights into the diversification of transport functions

    • The conservation of key functional residues across diverse transporters may reveal fundamental requirements for membrane transport

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.