Recombinant Salmonella schwarzengrund Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella schwarzengrund Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose Transferase (ArnC)

Recombinant Salmonella schwarzengrund Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC) is an enzyme that plays a crucial role in bacterial resistance to polymyxin antibiotics . ArnC is involved in modifying the lipid A component of lipopolysaccharides (LPS) in the outer membrane of Gram-negative bacteria, specifically by adding a 4-amino-4-deoxy-L-arabinose (Ara4N) headgroup . This modification reduces the effectiveness of polymyxins, which are last-resort antimicrobial peptides used against multi-drug resistant bacteria .

Function and Mechanism

ArnC is a glycosyltransferase enzyme that facilitates the transfer of 4-deoxy-4-formamido-L-arabinose to undecaprenyl phosphate . Specifically, ArnC N-formylates Ara4N prior to its transfer to undecaprenyl-phosphate . Deletion of the arnC gene reduces UndP-Ara4FN levels, confirming its role in UndP-Ara4FN formation . It is classified as a type-2 glycosyltransferase (GT-2) .

Role in Polymyxin Resistance

The arnBCDTEF operon encodes a series of enzymes that modify lipid A with an Ara4N headgroup, conferring resistance to polymyxins . ArnC is essential in this pathway, as it modifies lipid A, preventing polymyxins from effectively targeting and disrupting the bacterial outer membrane .

Key Research Findings

  • Cryo-EM Structures: Cryo-EM structures of Salmonella typhimurium ArnC have been resolved in both apo and UDP-bound forms at resolutions of 2.75 Å and 3.8 Å, respectively .

  • Tetramer Formation: ArnC forms a tetramer stabilized by multiple hydrogen bonds and salt bridges .

  • Conformational Changes: UDP binding induces conformational changes that stabilize the A-loop and catalytic pocket .

Recombinant ArnC Protein

Recombinant ArnC protein is produced in various expression systems, including E. coli, yeast, baculovirus, and mammalian cells . The recombinant protein often includes a His-tag for purification .

Table 1: Recombinant ArnC Protein Details

FeatureDescription
Gene NamearnC
SpeciesSalmonella schwarzengrund
SourceE. coli
TagHis-tag
Protein LengthFull Length (1-327 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃.
SynonymsarnC; SeSA_A2526; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
UniProt IDB4TPI1

Table 2: Production sources

SourceCode
YeastCSB-YP468137SWV1
E.coliCSB-EP468137SWV1
E.coliCSB-EP468137SWV1-B
BaculovirusCSB-BP468137SWV1
Mammalian cellCSB-MP468137SWV1

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
arnC; SeSA_A2526; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
arnC
Target Protein Sequence
MFDAAPIKKVSVVIPVYNEQESLPELIRRTTTACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTPFTEESHQ
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxin and cationic antimicrobial peptides.
Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) is a glycosyltransferase that plays a critical role in bacterial antimicrobial resistance mechanisms. It catalyzes the transfer of formylated aminoarabinose to the lipid undecaprenyl phosphate, enabling its association with the bacterial inner membrane. This enzyme is integral to the pathway that modifies Lipid A with aminoarabinose (L-Ara4N), which reduces binding of cationic antimicrobial peptides to the bacterial membrane, thus conferring resistance to polymyxin antibiotics . The enzyme belongs to the glycosyltransferase GT-A fold family and contains manganese ions that are essential for its catalytic function .

How does arnC contribute to polymyxin resistance in Gram-negative bacteria?

ArnC contributes to polymyxin resistance by facilitating a critical step in the modification of Lipid A. Specifically, it attaches a formylated form of aminoarabinose to undecaprenyl phosphate, creating a lipid-linked intermediate that can be transported across the membrane for eventual incorporation into Lipid A. This modification alters the charge characteristics of the bacterial outer membrane, reducing the electrostatic attraction between the negatively charged bacterial surface and positively charged polymyxins. Recent structural studies have revealed conformational transitions that occur upon substrate binding, providing insights into the catalytic mechanism that makes this resistance possible . Inhibiting this enzyme represents a potential strategy to combat polymyxin resistance in clinical settings.

What are the homologs of arnC across different bacterial species?

ArnC homologs are found in various Gram-negative bacteria, with significant sequence and functional conservation. The enzyme from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 has been structurally characterized by cryo-electron microscopy . Homologs in Salmonella paratyphi C (with UniProt ID C0Q070) share high sequence identity with the characterized enzyme . These proteins are typically referred to by synonyms including "Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase," "Undecaprenyl-phosphate Ara4FN transferase," and "Ara4FN transferase" . When studying arnC from Salmonella schwarzengrund, researchers should consider these evolutionary relationships to inform experimental design and interpretation of results.

What expression systems are optimal for recombinant arnC production?

For recombinant arnC production, E. coli has proven to be an effective expression host system. Based on available data, full-length arnC protein (amino acids 1-327) can be successfully expressed with an N-terminal His-tag in E. coli . As arnC is a membrane protein, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) may yield better results than standard strains. The expression construct should incorporate a strong promoter system with inducible control to manage expression levels, as overexpression of membrane proteins can be toxic to host cells. For structural studies requiring high protein yield, insect cell or mammalian expression systems might be considered as alternatives, though they require more complex methodology.

What purification strategy yields the highest quality recombinant arnC protein?

A multi-step purification strategy is recommended for obtaining high-quality recombinant arnC:

Table 1: Recommended Purification Protocol for Recombinant arnC Protein

Purification StepMethodPurposeCritical Parameters
Cell LysisSonication/French PressRelease protein from cellsBuffer with protease inhibitors
Membrane IsolationUltracentrifugationSeparate membrane fraction100,000×g, 1 hour
SolubilizationDetergent treatmentExtract protein from membraneChoose mild detergents (DDM, LMNG)
Affinity ChromatographyNi-NTACapture His-tagged proteinImidazole gradient elution
Size ExclusionGel filtrationRemove aggregatesBuffer with 0.05% detergent
Purity AssessmentSDS-PAGEVerify >90% puritySilver staining for sensitivity

This protocol has been successful for obtaining recombinant arnC with purity greater than 90% as determined by SDS-PAGE . The choice of detergent is crucial for maintaining protein stability and activity throughout the purification process.

How should recombinant arnC be stored to maintain stability and activity?

Based on empirical data, recombinant arnC can be stored as a lyophilized powder for long-term stability. For working solutions, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . The addition of glycerol to a final concentration of 5-50% is recommended for storage at -20°C/-80°C, with 50% being the standard concentration used in most protocols . The storage buffer typically consists of a Tris/PBS-based solution containing 6% trehalose at pH 8.0, which helps maintain protein stability . Aliquoting is essential to avoid repeated freeze-thaw cycles that can compromise protein integrity. For short-term use, working aliquots can be maintained at 4°C for up to one week without significant loss of activity .

What structural determination techniques have been successfully applied to arnC?

Cryo-electron microscopy (cryo-EM) has been successfully employed to determine the structure of ArnC from Salmonella enterica. The structure was determined in the UDP-bound state using a Talos Arctica microscope at a resolution of 2.96 Å . This technique is particularly suited for membrane proteins like arnC that can be challenging to crystallize. The cryo-EM approach revealed important conformational transitions that occur upon substrate binding, providing insights into the catalytic mechanism . Complementary techniques that could enhance structural understanding include hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions, and nuclear magnetic resonance (NMR) for studying specific domains or ligand interactions.

What are the key structural features of arnC revealed by cryo-EM studies?

Cryo-EM studies have revealed several critical structural features of arnC:

Table 2: Key Structural Features of ArnC Based on Cryo-EM Analysis

These structural details provide important insights into how arnC interacts with its substrates and catalyzes the transfer reaction, which is essential for understanding its role in antimicrobial resistance .

How can molecular dynamics simulations complement experimental structural data for arnC?

Molecular dynamics (MD) simulations offer valuable complementary information to static experimental structures of arnC. By embedding the cryo-EM structure in a simulated membrane environment, researchers can observe dynamic behaviors not captured in static structural snapshots. MD simulations can reveal: (1) conformational flexibility of catalytic loops, (2) pathways for substrate entry and product release, (3) water accessibility to the active site, and (4) lipid-protein interactions that might influence function. Coarse-grained and atomistic simulations have been used to provide insights into substrate coordination before and during catalysis for arnC . These computational approaches can also predict effects of mutations on protein stability and substrate binding, helping guide experimental design. When integrated with experimental data, MD simulations contribute to developing a comprehensive understanding of the catalytic mechanism.

What enzymatic assays can effectively measure arnC activity in vitro?

Several enzymatic assays can be employed to measure arnC activity in vitro:

Table 3: Enzymatic Assays for arnC Activity Measurement

Assay TypeMethodologyDetection MethodAdvantagesLimitations
Radioisotope-based¹⁴C/³H-labeled UDP-Ara4FN transfer to undecaprenyl phosphateScintillation countingHighly sensitive, quantitativeRequires radioactive materials
Coupled enzymeRelease of UDP monitored via coupling enzymesSpectrophotometricReal-time measurementPotential interference from coupling enzymes
HPLC-basedSeparation of substrate and productUV or fluorescence detectionDirect quantificationLower throughput
Mass spectrometryDetection of reaction productsMS or LC-MSHigh specificity, can detect multiple productsExpensive equipment required
Fluorescence-basedFRET or environmentally sensitive probesFluorescence spectroscopyReal-time kinetics, high throughputRequires modified substrates

When designing these assays, it is crucial to include appropriate metal cofactors, particularly manganese (Mn²⁺), which has been identified as an essential component in the active site of arnC .

How can researchers effectively study the metal-dependence of arnC activity?

The cryo-EM structure of arnC reveals the presence of manganese ions that are essential for its glycosyltransferase activity . To study this metal-dependence, researchers should employ a systematic approach: (1) Activity assays with varying concentrations of Mn²⁺ to determine optimal metal concentration; (2) Metal substitution studies using alternative divalent cations (Mg²⁺, Ca²⁺, Co²⁺, Ni²⁺) to assess specificity; (3) Site-directed mutagenesis of metal-coordinating residues identified in the structure; (4) Isothermal titration calorimetry (ITC) to measure binding affinity for different metal ions; (5) Electron paramagnetic resonance (EPR) spectroscopy for paramagnetic metals to probe the coordination environment; and (6) Metal chelation experiments using EDTA or similar chelators to demonstrate metal requirement. These approaches will help establish the specific role of metal ions in the catalytic mechanism of arnC.

What approaches can determine the substrate specificity of arnC?

To rigorously determine substrate specificity of arnC, researchers should implement a multi-faceted approach:

  • Kinetic analysis: Determine Km and kcat values for natural substrates (UDP-4-deoxy-4-formamido-L-arabinose and undecaprenyl phosphate) and potential alternative substrates.

  • Substrate analogs: Synthesize and test structural analogs of both donor and acceptor substrates with systematic modifications to identify essential chemical features.

  • Structure-guided mutagenesis: Based on the cryo-EM structure showing UDP binding , mutate residues in the substrate binding pocket to alter specificity.

  • Competitive inhibition assays: Use potential alternative substrates as inhibitors to assess their binding affinity.

  • Product analysis: Employ mass spectrometry to characterize the exact structure of reaction products from different substrates.

  • Computational docking: Use the arnC structure to predict binding modes of alternative substrates.

This systematic approach will establish the substrate scope of arnC, which is critical for understanding its biological function and developing potential inhibitors.

How can researchers quantify the contribution of arnC to polymyxin resistance?

Quantifying arnC's contribution to polymyxin resistance requires multiple complementary approaches:

Table 4: Methods to Quantify arnC's Contribution to Polymyxin Resistance

MethodApproachMeasurable OutcomesData Interpretation
Gene DeletionCreate ΔarnC knockoutChange in polymyxin MICDirect measure of contribution
Controlled ExpressionInducible arnC expressionDose-response relationshipQuantitative correlation
Point MutationsStructure-guided mutations Effect of specific residues on resistanceMechanistic insights
Mass SpectrometryLipidomic analysisQuantification of Ara4N-modified lipid ABiochemical confirmation
RNA SilencingarnC-targeted antisense RNAPartial knockdown effectsValidation of target
Heterologous ExpressionExpress in sensitive speciesGain of resistanceSufficiency test
Inhibitor StudiesApply arnC-specific inhibitorsRestoration of sensitivityPharmacological validation

When implementing these approaches, it's essential to control for potential compensatory mechanisms and to verify that observed changes in resistance are specifically due to altered arnC function rather than secondary effects.

What experimental approaches can identify potential inhibitors of arnC?

Identification of arnC inhibitors can be approached through several complementary strategies:

  • Structure-based virtual screening: Utilize the cryo-EM structure of arnC to computationally screen compound libraries for molecules predicted to bind to the active site or allosteric sites.

  • Fragment-based screening: Screen libraries of small molecular fragments that can be later elaborated into more potent inhibitors.

  • High-throughput biochemical assays: Develop miniaturized versions of arnC activity assays amenable to screening compound libraries.

  • Competitive binding assays: Measure displacement of natural substrates (UDP or undecaprenyl phosphate) by potential inhibitors.

  • Thermal shift assays: Identify compounds that alter protein stability upon binding.

  • Whole-cell phenotypic screening: Screen for compounds that sensitize polymyxin-resistant bacteria to polymyxin, followed by target validation to confirm arnC inhibition.

  • Rational design based on transition state: Design molecules that mimic the transition state of the glycosyl transfer reaction catalyzed by arnC.

These approaches can be conducted in parallel to maximize the chances of identifying novel inhibitors with therapeutic potential.

How can the regulatory mechanisms controlling arnC expression be characterized?

Characterizing the regulatory mechanisms controlling arnC expression requires a comprehensive approach:

  • Promoter analysis: Identify regulatory elements in the arnC promoter region using bioinformatics and reporter gene assays.

  • Transcription factor binding: Employ chromatin immunoprecipitation (ChIP) to identify transcription factors that bind to the arnC promoter.

  • Environmental regulation: Measure arnC expression under different conditions (pH, antimicrobial peptides, divalent cation concentrations) using qRT-PCR.

  • Two-component systems: Investigate the role of known regulatory systems (PhoP/PhoQ, PmrA/PmrB) using genetic approaches such as deletion mutants.

  • RNA-based regulation: Examine potential post-transcriptional regulation through small RNAs or riboswitches.

  • Proteomics: Quantify arnC protein levels under different conditions using targeted mass spectrometry.

  • Single-cell analysis: Use fluorescent reporter fusions to investigate cell-to-cell variability in arnC expression.

This multi-faceted approach will provide insights into how bacteria regulate arnC expression in response to environmental cues, potentially revealing new strategies to prevent the induction of polymyxin resistance.

What considerations are critical when designing site-directed mutagenesis studies of arnC?

When designing site-directed mutagenesis studies of arnC, researchers should consider several critical factors:

This systematic approach will maximize the information gained from mutagenesis studies and help establish structure-function relationships for arnC.

How can researchers distinguish between direct and indirect effects when studying arnC in vivo?

Distinguishing between direct and indirect effects when studying arnC in vivo requires careful experimental design:

  • Complementation studies: Use plasmid-based expression of wild-type arnC in knockout strains to verify that phenotypes can be rescued.

  • Point mutations: Employ catalytically inactive mutants (based on structural data ) that maintain proper folding but lack activity.

  • Conditional expression: Use tightly regulated inducible promoters to control the timing and level of arnC expression.

  • Biochemical validation: Directly measure arnC-catalyzed reaction products (Ara4FN-modified undecaprenyl phosphate) in membrane extracts.

  • Targeted metabolomics: Track specific metabolic precursors and products in the arnC pathway.

  • Genetic epistasis: Analyze double mutants of arnC with other genes in the polymyxin resistance pathway.

  • Time-course analysis: Monitor changes in resistance and lipid modifications at different time points after arnC induction or inhibition.

These approaches help establish causality rather than mere correlation between arnC activity and observed phenotypes.

What methods are most effective for reconstituting purified arnC into membrane mimetics?

For functional studies of purified arnC, effective reconstitution into membrane mimetics is crucial:

Table 5: Membrane Mimetic Systems for Reconstituted arnC Studies

Mimetic SystemCompositionBest ApplicationsAdvantagesChallenges
ProteoliposomesPhospholipid vesiclesFunctional assays, transport studiesNative-like bilayer environmentHeterogeneous orientation
NanodiscsPhospholipids + scaffold proteinStructural studies, single-molecule measurementsDefined size, accessible from both sidesComplex assembly
AmphipolsAmphipathic polymersCryo-EM, biophysical studiesStabilization without detergentsNot a true bilayer
BicellesLong- and short-chain phospholipidsNMR studies, crystallizationDisc-shaped bilayersLimited stability
Styrene-maleic acid lipid particles (SMALPs)Native membrane extractionFunctional studies with native lipidsPreserves native lipid environmentVariable size distribution

The choice of system should be guided by the specific experimental objectives. For structural studies like those that yielded the cryo-EM structure , nanodiscs or amphipols may be preferred, while functional assays might benefit from proteoliposomes that more closely mimic the native membrane environment.

How can researchers resolve contradictory findings in arnC functional studies?

When confronted with contradictory findings in arnC functional studies, researchers should implement a systematic troubleshooting approach:

  • Methodological differences: Carefully examine differences in experimental protocols, including protein purification methods, buffer compositions, and assay conditions.

  • Strain specificity: Consider that results may differ between Salmonella strains (e.g., S. schwarzengrund vs. S. enterica vs. S. paratyphi C ), as genetic background can influence enzyme function.

  • Protein constructs: Verify that protein constructs (including tags, linkers, and fusion partners) are comparable between studies.

  • Activity verification: Employ multiple complementary assays to confirm enzyme activity rather than relying on a single readout.

  • Statistical analysis: Use appropriate statistical methods to determine if apparent contradictions are statistically significant or within experimental error.

  • Replication: Independently replicate key experiments under identical conditions to confirm reproducibility.

  • Meta-analysis: Systematically compare all available data across studies to identify patterns and potential sources of variability.

By methodically addressing these factors, researchers can often reconcile seemingly contradictory findings and develop a more nuanced understanding of arnC function.

What approaches are recommended for analyzing structure-function relationships in arnC?

For comprehensive analysis of structure-function relationships in arnC, integrate multiple approaches:

  • Structure-guided mutagenesis: Use the cryo-EM structure to design mutations targeting specific structural elements, followed by functional assays.

  • Computational simulations: Employ molecular dynamics simulations to model conformational changes and substrate interactions, based on the experimental structure.

  • Domain swapping: Create chimeric proteins with domains from homologous enzymes to identify regions responsible for specific functions.

  • Ligand binding studies: Use isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or microscale thermophoresis (MST) to quantify binding interactions.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map regions of conformational flexibility and ligand-induced structural changes.

  • Cross-linking coupled with mass spectrometry (XL-MS): Identify spatial relationships between protein regions in different functional states.

  • In silico docking and virtual screening: Predict binding modes of substrates, products, and potential inhibitors.

Integration of these approaches provides a comprehensive understanding of how arnC structure determines its catalytic function in antimicrobial resistance.

How can researchers integrate arnC studies with broader antimicrobial resistance research?

Integrating arnC studies within the broader context of antimicrobial resistance research requires a multidisciplinary approach:

  • Systems biology: Position arnC within network models of polymyxin resistance mechanisms, including connected pathways and regulatory systems.

  • Clinical isolate studies: Examine arnC sequence variations, expression levels, and activity in clinical isolates with different resistance profiles.

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data to understand how arnC fits into global cellular responses to antimicrobial challenge.

  • Combination therapy approaches: Investigate how potential arnC inhibitors might synergize with existing antibiotics.

  • Evolutionary studies: Analyze the conservation and divergence of arnC across bacterial species and in response to selective pressure.

  • Host-pathogen interactions: Examine how arnC-mediated modifications affect bacterial interactions with host immune systems.

  • Translational research: Develop screening platforms for identifying arnC inhibitors with potential clinical applications.

This integrated approach ensures that basic research on arnC structure and function contributes meaningfully to addressing the global challenge of antimicrobial resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.