Recombinant Salmonella schwarzengrund UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates. Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. Tag type is determined during production. To prioritize a specific tag, please specify your requirements.
Synonyms
yqhA; SeSA_A3336; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
yqhA
Target Protein Sequence
MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining YqhA protein stability?

For optimal stability of recombinant YqhA protein, the following evidence-based storage protocols are recommended:

Storage FormTemperatureBuffer CompositionShelf LifeNotes
Lyophilized-20°C to -80°CTris/PBS-based buffer with 6% trehalose, pH 8.012 monthsFor extended storage
Reconstituted-20°C to -80°CAdd 5-50% glycerol as cryoprotectant6 monthsAliquot to avoid freeze-thaw cycles
Working solution4°COriginal bufferUp to 1 weekFor immediate use

Repeated freeze-thaw cycles significantly decrease protein stability and should be avoided by preparing appropriate working aliquots. For reconstitution, it is recommended to briefly centrifuge the vial prior to opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What bioinformatic approaches can be used to analyze the structure-function relationship of YqhA protein?

Comprehensive structural and functional analysis of YqhA requires a multi-level bioinformatic approach:

These approaches should be integrated with experimental data to develop hypotheses about YqhA's role in Salmonella biology.

What experimental methods are most effective for studying YqhA protein-protein interactions?

Several complementary experimental approaches can be employed to investigate YqhA protein-protein interactions:

  • Affinity-based methods: Pull-down assays using His-tagged recombinant YqhA as bait can identify potential binding partners from Salmonella lysates. This approach benefits from the availability of purified recombinant YqhA protein with His tags .

  • Co-immunoprecipitation (Co-IP): Using specific antibodies against YqhA to precipitate the protein along with its interacting partners from Salmonella cell extracts. This technique is particularly valuable for confirming interactions in a more native context.

  • Yeast two-hybrid (Y2H) screening: While challenging for transmembrane proteins like YqhA, modified Y2H systems designed for membrane proteins can identify potential interacting partners.

  • Bacterial two-hybrid systems: These may be more appropriate than Y2H for bacterial proteins like YqhA and can provide information about interactions in a prokaryotic cellular environment.

  • Crosslinking combined with mass spectrometry: This approach can capture transient interactions and identify interaction sites within protein complexes.

When analyzing results, researchers should consider that YqhA is a membrane protein (as evidenced by its sequence features ), which may complicate the interpretation of interaction data and require specialized approaches for membrane protein analysis.

How does the YqhA protein sequence conservation vary across different Salmonella serovars?

The YqhA protein demonstrates remarkable sequence conservation across multiple Salmonella serovars. Based on the available amino acid sequences from multiple sources , we can construct the following comparison:

Salmonella SerovarUniProt IDSequence Identity to S. schwarzengrundKey Variations
S. schwarzengrundB4TVN6100% (reference)None (reference)
S. paratyphi BA9N4W6100%None detected
S. paratyphi AB5BFW5100%None detected
S. newportB4T5R6100%None detected
S. choleraesuisQ57JW1100%None detected
S. paratyphi C-100%None detected

This extreme conservation suggests that YqhA likely plays an essential role in Salmonella biology. The protein contains membrane-spanning regions and features that are consistent across serovars, indicating functional constraints on sequence variation. This conservation contrasts with the genetic diversity observed in many other Salmonella genes and may reflect the importance of YqhA in core cellular functions rather than in host adaptation or virulence-specific processes .

What are the implications of YqhA conservation for Salmonella evolution and pathogenesis?

The remarkable conservation of YqhA across Salmonella serovars has significant implications for understanding Salmonella evolution and pathogenesis:

  • Evolutionary constraint: The high sequence identity suggests strong purifying selection, indicating that YqhA likely serves a fundamental function in Salmonella biology. This contrasts with many virulence-associated genes that show greater variability due to host adaptation pressures .

  • Horizontal gene transfer resistance: Unlike many Salmonella genes that undergo horizontal gene transfer (HGT), the conservation of YqhA suggests it may be part of the core genome that resists recombination events. This is notable given that Salmonella genomes frequently undergo HGT, which has driven the emergence of adapted strains in various environments .

  • Potential role in basic cellular functions: The UPF0114 family designation indicates an uncharacterized protein family, but the high conservation suggests YqhA may be involved in fundamental membrane-associated processes rather than in specialized virulence mechanisms.

  • Diagnostic and therapeutic target potential: Highly conserved proteins can serve as excellent diagnostic markers or antimicrobial targets. The conservation of YqhA across pathogenic Salmonella serovars suggests it could potentially serve as a universal target for detection or treatment strategies .

The conservation pattern of YqhA stands in contrast to the extensive genetic recombination observed in many Salmonella genomic regions, particularly those associated with virulence and host adaptation. This suggests that while HGT drives the evolution of specialized pathogenic traits, core proteins like YqhA remain relatively unchanged, potentially serving as genomic anchors during Salmonella evolution .

How can recombinant YqhA protein be utilized in Salmonella vaccine development strategies?

While YqhA itself has not been extensively explored as a primary vaccine antigen, the methodological approaches used with other Salmonella proteins can be applied to evaluate its potential. The following research strategies are recommended:

  • Antigenicity assessment: Recombinant YqhA protein can be evaluated for its ability to stimulate immune responses in animal models, measuring both humoral (antibody) and cell-mediated responses. The high conservation of YqhA across Salmonella serovars suggests it might elicit cross-protective immunity .

  • Carrier protein applications: Recombinant Salmonella expressing YqhA fused with heterologous antigens could potentially serve as live vaccine vectors. This approach has been demonstrated with other Salmonella proteins like PspA from Streptococcus pneumoniae, where recombinant attenuated Salmonella Typhi vaccine (RASTyV) strains expressing heterologous antigens showed promise in preclinical studies .

  • Adjuvant formulation optimization: When using purified recombinant YqhA in subunit vaccine approaches, researchers should evaluate multiple adjuvant formulations to enhance immunogenicity. This is particularly important for membrane proteins that may have complex tertiary structures .

  • Protection studies: Animal challenge models using various Salmonella serovars can assess the protective efficacy of YqhA-based immunization. The methodology used in studies with other Salmonella proteins like InvH (which achieved 100% protection against homologous challenge and 90% against heterologous serovars) provides a useful template .

It's worth noting that membrane proteins like YqhA present both challenges (complex folding, potential hydrophobicity) and opportunities (conservation across serovars, potential surface exposure) in vaccine development contexts .

What challenges exist in using YqhA protein in recombinant vaccine designs?

Several significant challenges must be addressed when considering YqhA protein for recombinant vaccine applications:

  • Protein solubility and folding: As a membrane-associated protein, YqhA may present solubility challenges when expressed recombinantly. Researchers should consider various expression strategies, including the use of solubility tags or membrane-mimetic environments during purification to maintain native conformation .

  • Maintaining conformational epitopes: The immunologically relevant epitopes of membrane proteins often depend on proper folding. Expression systems and purification methods must be optimized to preserve these structural features. The methodology used for other recombinant Salmonella proteins in vaccine development can serve as a starting point .

  • Cross-protection assessment: While the high sequence conservation of YqhA across Salmonella serovars suggests potential cross-protection, experimental validation is essential. Challenge studies with multiple serovars, similar to those conducted with the InvH protein (which demonstrated both homologous and heterologous protection), would be necessary .

  • Protein yield optimization: Achieving sufficient yields of properly folded recombinant YqhA protein may require systematic optimization of expression conditions, including induction parameters, host strain selection, and purification protocols .

  • Immune response characterization: Researchers must determine whether YqhA elicits appropriate immune responses (both humoral and cell-mediated) for protective immunity against Salmonella. This requires comprehensive immunological profiling using methodologies similar to those employed in other Salmonella vaccine studies .

These challenges highlight the importance of a systematic approach to evaluating YqhA's potential in vaccine applications, building on methodologies that have proven successful with other Salmonella proteins.

What role might YqhA play in Salmonella pathogenesis based on current knowledge?

While the specific function of YqhA remains uncharacterized (as indicated by the UPF0114 designation), several lines of evidence allow us to formulate hypotheses about its potential role in Salmonella pathogenesis:

  • Membrane localization: The amino acid sequence analysis reveals multiple transmembrane domains, suggesting YqhA is an integral membrane protein . This localization may implicate it in processes such as:

    • Membrane integrity maintenance

    • Transport functions

    • Environmental sensing

    • Host-pathogen interface interactions

  • Sequence conservation: The remarkable conservation of YqhA across Salmonella serovars suggests it performs an essential function. This level of conservation is more consistent with a role in fundamental cellular processes rather than specialized virulence mechanisms, which typically show greater variation due to host adaptation pressures .

  • Genomic context analysis: While not explicitly detailed in the search results, examination of genes surrounding yqhA in the Salmonella genome could provide functional clues through guilt-by-association approaches. Nearby genes involved in membrane functions or metabolic processes might suggest functional relationships.

  • Potential involvement in stress response: Many conserved bacterial membrane proteins participate in stress response systems. The survival of Salmonella under various environmental conditions, including food preservation methods and host immune defenses, often depends on such systems .

While direct evidence for YqhA's role in pathogenesis is limited, its membrane localization and high conservation make it a candidate for involvement in fundamental processes that support Salmonella's survival during infection or environmental persistence.

What novel detection methods could be developed based on recombinant YqhA protein?

The recombinant YqhA protein offers several possibilities for developing advanced Salmonella detection methods with potential advantages over current techniques:

  • Recombinant plasmid-based quantitative Real-Time PCR: While not directly targeting the yqhA gene, the methodology described for other Salmonella genes could be applied to yqhA. This approach would use recombinant plasmids containing the yqhA sequence as standardized positive controls, offering:

    • Rapid detection (21 hours compared to 90 hours for traditional culture methods)

    • Quantitative evaluation with low detection limits

    • Standardization across different laboratories

  • Antibody-based detection systems: Recombinant YqhA protein can be used to develop specific antibodies for immunological detection methods:

    • ELISA-based detection systems using anti-YqhA antibodies

    • Lateral flow immunoassays for point-of-need testing

    • Immunomagnetic separation combined with PCR or culture methods

  • Biosensor platforms: The conserved nature of YqhA across Salmonella serovars makes it an attractive target for biosensor development:

    • Surface plasmon resonance (SPR) sensors functionalized with anti-YqhA antibodies

    • Electrochemical biosensors using aptamers selected against recombinant YqhA

    • Field-effect transistor (FET) biosensors for electronic detection

The advantages of developing detection methods based on YqhA include potential broad-spectrum detection of multiple Salmonella serovars due to the high sequence conservation, and the possibility of detecting viable but non-culturable (VBNC) Salmonella that might be missed by traditional culture methods .

How can structural biology approaches advance understanding of YqhA function?

Given the limited functional characterization of YqhA, structural biology approaches could provide critical insights into its biological role:

  • X-ray crystallography challenges and solutions: As a membrane protein, YqhA presents significant challenges for crystallization. Researchers should consider:

    • Detergent screening to identify optimal micelle-forming conditions

    • Lipidic cubic phase crystallization methods specifically designed for membrane proteins

    • Crystallization chaperones or antibody fragments to stabilize flexible regions

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology and could be applied to YqhA:

    • Single-particle analysis for purified YqhA in membrane mimetics

    • In situ structural studies of YqhA within the native membrane environment

    • Structural characterization of YqhA in complex with potential binding partners

  • NMR spectroscopy applications: Solution and solid-state NMR can provide valuable dynamics information:

    • Solution NMR for detergent-solubilized YqhA domains

    • Solid-state NMR for full-length YqhA in lipid bilayers

    • Analysis of YqhA interactions with lipids or other proteins

  • Integrative structural biology: Combining multiple techniques with computational methods:

    • Molecular dynamics simulations to study YqhA within membrane environments

    • Evolutionary coupling analysis to predict structural contacts

    • Hydrogen-deuterium exchange mass spectrometry to identify exposed regions

Understanding YqhA's structure could lead to hypotheses about its function, potentially revealing whether it participates in transport, signaling, or structural roles within the Salmonella membrane. The methodological approaches outlined here build upon general principles of membrane protein structural biology while addressing the specific challenges presented by this uncharacterized protein .

What are the optimal reconstitution and handling protocols for recombinant YqhA protein in experimental settings?

Based on the published protocols for recombinant YqhA protein, the following evidence-based handling procedures are recommended for research applications:

  • Reconstitution protocol:

    • Centrifuge the lyophilized protein vial briefly before opening to collect all material at the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended for long-term storage)

    • Mix gently by pipetting; avoid vigorous shaking or vortexing which may cause protein denaturation

  • Storage recommendations:

    • For long-term storage: Aliquot reconstituted protein and store at -20°C or preferably -80°C

    • For short-term use: Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they significantly diminish protein activity

  • Handling considerations for membrane proteins:

    • When working with YqhA, consider its membrane protein nature which may affect solubility

    • Maintain appropriate buffer conditions (Tris/PBS-based buffer, pH 8.0) to prevent precipitation

    • If necessary, include mild detergents to maintain protein solubility, though this should be optimized for specific downstream applications

These recommendations are based on standard protocols for recombinant YqhA from multiple Salmonella serovars, but researchers should optimize conditions for their specific experimental requirements and verify protein integrity before critical experiments.

How should researchers approach experimental design when studying the function of an uncharacterized protein like YqhA?

When investigating an uncharacterized protein like YqhA (UPF0114 family), a systematic multi-faceted approach is recommended:

  • Comparative genomics foundation:

    • Analyze genomic context of yqhA across multiple Salmonella serovars

    • Identify co-expressed genes and potential functional associations

    • Examine conservation patterns to infer selective pressures and evolutionary importance

  • Gene knockout and phenotypic analysis:

    • Generate precise yqhA deletion mutants using CRISPR-Cas9 or lambda Red recombination

    • Conduct comprehensive phenotypic screening including:

      • Growth under various stress conditions (temperature, pH, osmotic stress)

      • Survival in relevant environmental conditions (food matrices, water, soil)

      • Virulence assessment in appropriate infection models

      • Membrane integrity and transport function analyses

  • Protein localization and interaction studies:

    • Determine subcellular localization using fluorescent protein fusions or immunolocalization

    • Identify interaction partners through pull-down assays or crosslinking mass spectrometry

    • Conduct membrane proteomics to identify co-localized proteins

  • Functional complementation approaches:

    • Express YqhA in heterologous systems with defined mutant backgrounds

    • Test for restoration of specific phenotypes

    • Consider complementation with orthologs from other bacteria to identify functional conservation

  • Controls and validation:

    • Include appropriate controls in all experiments (empty vector controls, wild-type references)

    • Validate findings through multiple methodological approaches

    • Confirm that phenotypes can be complemented by wild-type yqhA expression

This methodological framework provides a systematic path to uncovering the function of YqhA, moving from in silico analysis to in vivo functional characterization while maintaining scientific rigor throughout the process.

What emerging technologies could accelerate functional characterization of YqhA and related proteins?

Several cutting-edge technologies show promise for elucidating the function of uncharacterized proteins like YqhA:

  • CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa):

    • Allows tunable repression or activation of yqhA expression

    • Enables temporal control of gene expression to study acute vs. chronic effects

    • Facilitates studying essential genes where complete knockout might be lethal

    • Can be combined with high-throughput phenotypic screens to identify conditions where YqhA function is critical

  • Proximity labeling proteomics:

    • Technologies like BioID or APEX2 can be fused to YqhA to label proximal proteins

    • Provides spatial context for protein function in the membrane environment

    • Identifies transient interactions that may be missed by traditional co-immunoprecipitation

    • Can be performed under various conditions to map dynamic interaction networks

  • High-throughput structural prediction with AlphaFold2 and RoseTTAFold:

    • Leverage AI-based structural prediction to generate testable hypotheses about YqhA function

    • Compare predicted structures across various UPF0114 family members

    • Identify potential ligand binding sites or functional domains

    • Guide rational design of experiments to test structure-function relationships

  • Single-cell approaches:

    • Single-cell RNA-seq to identify conditions that modulate yqhA expression

    • Time-lapse microscopy with fluorescent reporters to study dynamic regulation

    • Microfluidic approaches to examine YqhA's role in response to environmental changes

  • Metaproteomics in complex environments:

    • Study YqhA expression in complex microbial communities

    • Examine regulation in food systems, environmental samples, or host-associated contexts

    • Understand ecological context of YqhA function

These emerging technologies, when applied systematically, could rapidly advance understanding of YqhA function beyond what traditional approaches might achieve in isolation.

How might systems biology approaches integrate YqhA into the broader understanding of Salmonella pathogenesis?

Systems biology offers powerful frameworks to contextualize YqhA within the complex networks governing Salmonella pathogenesis:

  • Network integration approaches:

    • Integrate transcriptomic, proteomic, and metabolomic data to position YqhA within functional networks

    • Apply Bayesian network analysis to infer causal relationships between YqhA and other cellular components

    • Utilize weighted gene co-expression network analysis (WGCNA) to identify modules of genes with similar expression patterns to yqhA

  • Multi-omics data integration:

    • Correlate yqhA expression with global changes in proteome, metabolome, and lipidome

    • Map condition-specific regulation of yqhA across diverse environmental conditions

    • Develop predictive models for YqhA function based on multi-omic signatures

  • Host-pathogen interaction modeling:

    • Incorporate YqhA into existing models of Salmonella-host interactions

    • Determine if YqhA contributes to specific stages of infection or persistence

    • Evaluate YqhA's potential role in horizontal gene transfer and recombination events that shape Salmonella evolution

  • Comparative systems analysis across serovars:

    • Compare network positioning of YqhA across different Salmonella serovars

    • Identify serovar-specific regulatory patterns despite sequence conservation

    • Correlate network differences with host specificity or virulence characteristics

  • Machine learning applications:

    • Apply supervised learning algorithms to predict conditions where YqhA function is critical

    • Use unsupervised learning to identify patterns in high-dimensional data related to YqhA

    • Develop predictive models for antimicrobial resistance that incorporate YqhA status

This systems-level integration would position YqhA within the broader context of Salmonella biology, potentially revealing unexpected connections to virulence, metabolism, or stress response pathways that aren't evident from reductionist approaches alone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.