Recombinant Salmonella schwarzengrund UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycjF; SeSA_A1809; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFAEPLKEEPTSVFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIVGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPALQRWYAAIHE TQNDREIVGLYAHLVQPVLDAQARREISRFAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is known about the membrane topology of YcjF protein?

YcjF is classified as a membrane protein belonging to the UPF0283 family. Research indicates that it contains multiple transmembrane domains that anchor it within the bacterial membrane. The protein's topology features both cytoplasmic and periplasmic domains, which likely facilitate its putative role in two-component signaling systems. Comparative analyses with YcjF homologs in E. fergusonii and other species suggest a conserved topology with similar functional domains.

For structural studies, researchers typically focus on:

  • Identifying ATP-binding domains

  • Mapping dimerization interfaces

  • Characterizing transmembrane regions

These structural elements are critical for understanding the protein's function in bacterial response to environmental stimuli.

What expression systems are optimal for producing recombinant YcjF?

Multiple expression systems can be employed for recombinant YcjF production, each with distinct advantages:

Expression SystemCharacteristicsApplications
E. coli (e.g., BL21)High yield, cost-effective, N-terminal His-tag possibleStructural studies, antibody production
YeastPost-translational modifications, potential for higher solubilityComplex functional assays
BaculovirusEnhanced folding for complex membrane proteinsStructural and functional analyses
Mammalian cellsNative-like post-translational modificationsStudies requiring authentic protein conformation

For most research applications, E. coli expression systems yield sufficient quantities of functional protein with >90% purity as verified by SDS-PAGE . The selection of an appropriate expression system should be guided by the specific experimental requirements and downstream applications.

What are the recommended storage and reconstitution protocols for recombinant YcjF?

For optimal stability and activity, recombinant YcjF should be managed as follows:

Storage conditions:

  • Short-term: -20°C in appropriate buffer

  • Long-term: -80°C with aliquoting to prevent freeze-thaw cycles

  • Buffer composition: Tris/PBS-based buffer with 6% trehalose at pH 8.0

Reconstitution procedure:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is commonly used)

  • Aliquot for storage to minimize repeated freeze-thaw cycles

These protocols maintain protein integrity and functional activity for experimental applications. Repeated freeze-thaw cycles significantly diminish protein quality and should be avoided.

How does YcjF operate within bacterial two-component signaling systems?

YcjF functions within bacterial two-component systems (TCSs), which are critical signaling mechanisms that allow bacteria to sense and respond to environmental changes. The protein is believed to participate in:

  • Signal transduction pathways following environmental stimuli

  • Phosphorylation cascades that regulate bacterial adaptation

  • Membrane-associated sensing of extracellular conditions

Research indicates that YcjF may contribute to bacterial adaptation mechanisms, particularly in response to stress conditions. Its precise role in phosphorylation mechanisms remains an active area of investigation, with implications for understanding bacterial survival in different environments.

What role does YcjF play in Salmonella pathogenicity studies?

The YcjF protein has been investigated in pathogenicity studies, particularly in relation to Salmonella virulence mechanisms. Studies with recombinant YcjF have revealed:

  • Its potential contribution to bacterial adaptation during host infection

  • Association with virulence factors identified in genomic studies

  • Possible roles in bacterial survival under host immune pressure

S. schwarzengrund strains harbor approximately 153 virulence genes, including the Saf operon and cdtB gene, which may interact with YcjF in pathogenicity networks . Comparative genomic analyses have identified YcjF as a conserved feature in virulent Salmonella strains, suggesting functional importance in infection processes.

How does the ycjF gene vary across Salmonella schwarzengrund isolates?

Genomic analyses of S. schwarzengrund isolates, including the comprehensive study of strain S16 from Korea, have revealed that the ycjF gene (annotated as STM1684 in some databases) is part of the core genome shared across isolates. A comparative genomic analysis of S. schwarzengrund yielded:

  • A pangenome of 7,112 genes

  • A core genome of 3,374 genes (including ycjF)

  • An accessory genome of 2,906 genes

  • 835 unique genes across different strains

The conservation of ycjF within the core genome suggests its fundamental importance to Salmonella biology, rather than being an accessory or strain-specific feature.

What is the relationship between YcjF and antibiotic resistance in S. schwarzengrund?

While YcjF itself is not directly identified as an antibiotic resistance determinant, S. schwarzengrund strains expressing this protein often exhibit resistance profiles that warrant investigation. Recent studies have identified:

  • Strains carrying an IncFIB-IncFIC(FII) fusion plasmid that confers streptomycin resistance

  • Resistance to multiple antibiotics including amikacin, ciprofloxacin, sulfamethoxazole, and tetracycline

  • Mutations in genes like gyrB that contribute to resistance phenotypes

Of 55 food and clinical S. schwarzengrund isolates examined, 17 were found to contain this fusion plasmid. The plasmid was detected in 9 food isolates (primarily from poultry meat) and 8 clinical isolates from human samples (stool, urine, and gallbladder) .

SNP-based phylogenetic analyses indicated that isolates carrying the fusion plasmid formed a distinct subclade, suggesting the plasmid was acquired and maintained within a specific lineage. The plasmid appears to be derived from avian pathogenic plasmids and may confer adaptive advantages to S. schwarzengrund .

What experimental controls are essential when working with recombinant YcjF?

When designing experiments with recombinant YcjF, multiple controls should be implemented to ensure valid and reproducible results:

  • Protein quality controls:

    • SDS-PAGE to verify purity (>85-90% purity is standard)

    • Western blot to confirm identity and integrity

    • Size exclusion chromatography to assess oligomeric state

  • Functional controls:

    • Inactive protein variants (site-directed mutants) as negative controls

    • Known functional homologs from related species as positive controls

    • Buffer-only conditions to establish baseline measurements

  • Expression system controls:

    • Empty vector transformants processed identically to YcjF-expressing strains

    • Host cell background controls to account for host-derived contaminants

These controls help distinguish true biological effects from artifacts and ensure experimental validity when studying membrane proteins like YcjF .

How can researchers effectively study YcjF's role in bacterial adaptation to environmental stress?

To investigate YcjF's function in bacterial stress responses, researchers should consider implementing these methodological approaches:

  • Gene knockout and complementation studies:

    • Generate ycjF deletion mutants in S. schwarzengrund

    • Complement with wild-type and mutant variants

    • Compare phenotypes under various stress conditions

  • Protein interaction studies:

    • Affinity purification coupled with mass spectrometry to identify interaction partners

    • Bacterial two-hybrid assays to confirm specific protein-protein interactions

    • Fluorescence microscopy with tagged proteins to assess colocalization

  • Transcriptomic and proteomic analyses:

    • RNA-seq to identify genes differentially expressed in ycjF mutants

    • Quantitative proteomics to assess changes in protein abundance

    • Phosphoproteomic analysis to study signaling pathway alterations

These approaches can reveal how YcjF contributes to bacterial adaptation mechanisms at the molecular level, particularly in response to conditions mimicking the host environment during infection .

How do clinical and food isolates of S. schwarzengrund differ in their YcjF characteristics?

S. schwarzengrund isolates from different sources exhibit variations that may affect YcjF expression and function. A comprehensive study of 55 food and clinical isolates revealed:

  • Genetic relatedness patterns:

    • Clinical isolates often form phylogenetic clusters distinct from food isolates

    • Plasmid content varies between clinical and food sources

    • SNP profiles indicate evolutionary relationships between strains

  • Virulence factor differences:

    • Clinical isolates may carry additional virulence determinants

    • The complement of 153 virulence genes is generally conserved across isolates

    • Expression levels of virulence factors may differ between clinical and food isolates

Understanding these variations is essential for interpreting experimental results and for establishing the clinical relevance of YcjF in different S. schwarzengrund strains.

What methodologies are recommended for comparing YcjF function across different Salmonella serovars?

When conducting comparative studies of YcjF across Salmonella serovars, researchers should implement a systematic approach:

  • Sequence and structural comparison:

    • Multiple sequence alignment of ycjF genes and proteins

    • Homology modeling to predict structural differences

    • Analysis of conserved domains and variable regions

  • Functional complementation:

    • Cross-serovar gene replacement experiments

    • Heterologous expression of YcjF variants in common genetic backgrounds

    • Assessment of phenotypic rescue capabilities

  • Biochemical characterization:

    • Comparative enzyme kinetics if enzymatic activity is present

    • Binding affinity measurements for interaction partners

    • Stability assessments under various environmental conditions

These methodologies provide insights into functional conservation and divergence of YcjF across Salmonella serovars, with implications for understanding serovar-specific pathogenicity mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.