Recombinant Salmonella schwarzengrund UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is primarily produced via recombinant expression in E. coli, leveraging bacterial systems for cost-effective and scalable synthesis . Purification involves affinity chromatography (His-tag) and SDS-PAGE validation .

Key Production Notes

  • Expression Region: Full-length (1–157 aa)

  • Lyophilization: Required for long-term storage (-20°C/-80°C)

  • Stability: Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week

Applications in Research

Recombinant yjjB is utilized in molecular biology and pathogenicity studies:

ApplicationDetails
Western Blot (WB)Detection of yjjB expression in bacterial lysates
ELISAAntibody-based assays for quantifying yjjB in samples
Functional StudiesInvestigating interactions with host cells or other bacterial proteins

Genomic and Pathogenic Context

While S. schwarzengrund is associated with antibiotic resistance (e.g., gyrB mutations) and virulence factors like the Saf operon , the role of yjjB in pathogenicity remains uncharacterized. Genomic analyses of S. schwarzengrund strains reveal:

  • Core-Genome: Includes 3,374 conserved genes across serovars

  • Accessory-Genome: Contains 2,906 variable genes, including potential virulence determinants

  • Unique Features: Strain-specific genes (e.g., 81 unique genes in S. schwarzengrund S16)

yjjB’s Genomic Position

  • Locus: SeSA_A4799 (Accession: B4TU22)

  • Classification: Hypothetical protein (UPF0442 family)

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
yjjB; SeSA_A4799; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
yjjB
Target Protein Sequence
MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What are the recommended protocols for reconstituting and storing Recombinant Salmonella schwarzengrund UPF0442 protein yjjB?

    Based on manufacturer recommendations, the following protocol is advised:

    Reconstitution:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% is commonly recommended)

    • Aliquot for long-term storage

    Storage:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freezing and thawing as this can compromise protein integrity

    Buffer Conditions:

    • The protein is typically provided in a Tris/PBS-based buffer with 6% Trehalose, at pH 8.0

  • How can researchers verify the purity and integrity of Recombinant Salmonella schwarzengrund UPF0442 protein yjjB preparations?

    Several complementary approaches are recommended:

    • SDS-PAGE analysis: Commercial preparations typically achieve >90% purity as determined by SDS-PAGE. Researchers should verify this by running a sample on a gel alongside appropriate molecular weight markers. The expected molecular weight of His-tagged yjjB protein is approximately 17-18 kDa .

    • Western blotting: Using antibodies against the His-tag or the protein itself to confirm identity and integrity.

    • Mass spectrometry: For precise mass confirmation and detection of any potential degradation products or post-translational modifications.

    • Dynamic light scattering (DLS): To assess homogeneity and detect potential aggregation.

    • Functional assays: While specific assays for yjjB are not well-established, researchers might consider membrane incorporation studies or specific binding assays if interaction partners are identified.

  • What expression systems and purification strategies are most effective for producing Recombinant Salmonella schwarzengrund UPF0442 protein yjjB?

    Expression Systems:

    • E. coli is the predominant expression system for this protein as documented in multiple commercial preparations

    • For potentially improved yield of membrane proteins, specialized E. coli strains such as C41(DE3), C43(DE3), or Lemo21(DE3) might be considered

    Expression Tags:

    • N-terminal His-tag is commonly used, facilitating purification via immobilized metal affinity chromatography (IMAC)

    • Alternative tags such as GST or MBP could be considered if solubility issues arise

    Purification Strategy:

    1. IMAC using Ni-NTA or similar resin as the primary capture step

    2. Optional secondary purification via ion exchange chromatography

    3. Size exclusion chromatography as a final polishing step

    4. For membrane proteins like yjjB, consider using appropriate detergents during purification

    Considerations for Membrane Proteins:

    • Lower induction temperatures (16-25°C) often improve proper folding

    • Inclusion of mild detergents like n-dodecyl-β-D-maltoside (DDM) may improve solubility and extraction

    • Consider using lipid nanodiscs or amphipols for stabilization after purification

Advanced Research Questions

  • What experimental approaches are recommended for studying the membrane topology and localization of UPF0442 protein yjjB?

    Given the hydrophobic nature and predicted membrane association of yjjB, several complementary approaches are recommended:

    Membrane Localization:

    • Fluorescent protein fusion (e.g., GFP-yjjB) combined with confocal microscopy

    • Subcellular fractionation followed by Western blotting

    • Immunogold electron microscopy using antibodies against yjjB or its tags

    Topology Mapping:

    • Cysteine scanning mutagenesis coupled with membrane-impermeable thiol-reactive probes

    • Protease accessibility assays to determine exposed regions

    • Reporter fusion approaches using dual reporters (e.g., PhoA for periplasmic orientation, GFP for cytoplasmic orientation)

    • SCAM (substituted cysteine accessibility method) to determine water-accessible residues

    Computational Analysis to Guide Experiments:

    • Transmembrane domain prediction using TMHMM, Phobius, or TOPCONS

    • Hydrophobicity analysis to identify potential membrane-spanning regions

    • Homology modeling against structurally characterized membrane proteins

    These approaches should be used in combination, as each has limitations and may provide complementary information about yjjB's membrane orientation and integration.

  • What genomic context and gene organization surrounds yjjB in Salmonella schwarzengrund, and how might this inform functional studies?

    Analysis of the genomic neighborhood of yjjB can provide valuable clues about its function. While detailed genomic context information is limited in the search results, a systematic approach would include:

    Genomic Context Analysis:

    • Examination of genes upstream and downstream of yjjB

    • Identification of potential operonic structures through transcriptional analysis

    • Comparative genomics across Salmonella strains and related bacteria to identify conserved gene neighborhoods

    Functional Implications:

    • Co-transcribed genes often participate in related functions

    • Conserved genomic neighborhoods across species strongly suggest functional relationships

    • Regulatory elements in the promoter region may indicate conditions under which yjjB is expressed

    Research Approaches:

    • RNA-seq analysis under various conditions to identify co-transcribed genes

    • Promoter analysis to identify transcription factor binding sites

    • Genetic complementation studies with the entire operon versus individual genes

    This genomic context analysis should be performed using databases such as KEGG, BioCyc, and STRING to develop functional hypotheses that can be experimentally tested.

  • How can researchers design effective knockout or mutation experiments to investigate yjjB function in Salmonella schwarzengrund?

    Based on established methodologies for Salmonella genetic manipulation, the following approaches are recommended:

    Gene Knockout Strategy:

    1. Lambda Red Recombinase Method:

      • Design primers with 40-50 bp homology to regions flanking yjjB gene and 20 bp homology to an antibiotic resistance cassette

      • Amplify the resistance marker (e.g., kanamycin resistance) with these primers

      • Transform Salmonella cells expressing lambda red recombinase with the PCR product

      • Select recombinants on appropriate antibiotic media

      • Verify the deletion by PCR and sequencing

    2. P22 Phage Transduction for Strain Transfer:

      • Once generated, the mutation can be transferred to different strain backgrounds using P22 phage transduction

      • This helps confirm the phenotype is linked to the mutation rather than secondary mutations

    Complementation Strategy:

    • Reintroduce the wild-type yjjB gene on a plasmid under its native promoter

    • Create point mutations in conserved residues to identify critical functional domains

    Phenotypic Analysis:

    • Compare growth under various stress conditions (osmotic, pH, temperature, nutrient limitation)

    • Assess membrane integrity using dye penetration assays

    • Evaluate survival during dehydration stress or other environmental challenges

    • Test antimicrobial susceptibility profiles

    These approaches would help establish the physiological role of yjjB in Salmonella schwarzengrund .

  • What is known about the role of UPF0442 protein yjjB in stress response and environmental adaptation in Salmonella?

    While specific information about yjjB's role in stress response is limited in the search results, a systematic approach to investigate this would include:

    Transcriptional Analysis:

    • RNA-seq or qRT-PCR to examine yjjB expression under various stress conditions (dehydration, osmotic stress, pH stress, antimicrobial exposure)

    • Promoter-reporter fusions to monitor expression patterns in real-time

    Comparative Phenotyping:

    • Wild-type vs. ΔyjjB knockout strain comparisons under various stress conditions

    • Survival assays during environmental stresses similar to those described for other Salmonella genes:

      • Dehydration tolerance (DT) assay, measuring viability after 22h dehydration

      • Long-term persistence (LTP) assay, measuring survival after extended storage at different temperatures

    Potential Role Based on Related Proteins:

    • As a putative membrane protein, yjjB might be involved in:

      • Maintaining membrane integrity during stress

      • Transport of osmoprotectants or other protective compounds

      • Sensing environmental signals and triggering adaptive responses

    Further research could investigate whether yjjB shows similar patterns to other stress-response genes in Salmonella, such as those involved in dehydration tolerance or antimicrobial resistance.

  • How might UPF0442 protein yjjB contribute to antimicrobial resistance mechanisms in Salmonella schwarzengrund?

    While the specific role of yjjB in antimicrobial resistance is not established in the search results, Salmonella Schwarzengrund strains have been reported to exhibit resistance to multiple antibiotics . To investigate potential contributions of yjjB:

    Experimental Approaches:

    • Determine minimum inhibitory concentrations (MICs) of various antibiotics for wild-type and ΔyjjB mutants

    • Investigate whether yjjB expression is induced by antibiotic exposure using qRT-PCR or transcriptomics

    • Examine membrane permeability changes in yjjB mutants using fluorescent dye uptake assays

    • Test for altered expression of known resistance genes in yjjB mutants

    Antimicrobial Resistance Profile in S. Schwarzengrund:

    Antimicrobial AgentResistance Reported in S. SchwarzengrundPotential Mechanism
    Gentamicin30% of isolatesAminoglycoside modifying enzymes
    Tetracycline16% of isolatesEfflux pumps, ribosomal protection
    Nitrofurantoin16% of isolatesReduced nitroreductase activity
    Trimethoprim+Sulfamethoxazole16% of isolatesAlternative DHFR, altered target binding

    If yjjB functions as a membrane protein, it could potentially contribute to resistance through:

    • Altering membrane permeability to antibiotics

    • Participating in efflux pump complexes

    • Sensing antibiotic presence and triggering adaptive responses

    • Stabilizing the membrane against antibiotic-induced damage

  • What protein-protein interaction studies have been conducted with UPF0442 protein yjjB, and what methods are recommended?

    While specific protein-protein interaction studies for yjjB are not documented in the search results, several methodological approaches would be suitable for identifying interaction partners:

    In Vitro Methods:

    • Pull-down assays using His-tagged recombinant yjjB as bait

    • Surface plasmon resonance (SPR) to measure direct interactions with candidate partners

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization of interactions

    • Crosslinking mass spectrometry (XL-MS) to capture transient or weak interactions

    In Vivo Methods:

    • Bacterial two-hybrid (B2H) screening

    • Co-immunoprecipitation followed by mass spectrometry identification

    • Fluorescence resonance energy transfer (FRET) for membrane protein interactions

    • Split-GFP complementation assays

    Computational Prediction:

    • Use STRING database to identify potential interaction partners based on:

      • Genomic context (neighboring genes)

      • Co-expression patterns

      • Text mining evidence

      • Homology to proteins with known interactions

    Membrane Protein Considerations:

    • Include appropriate detergents or lipid environments to maintain native conformation

    • Consider in-membrane techniques like MYTH (membrane yeast two-hybrid)

    • Use chemical crosslinkers that can penetrate membranes for in vivo studies

    These approaches should be used in combination to build a comprehensive interaction network for yjjB.

  • What structural studies have been performed on UPF0442 protein yjjB, and what challenges exist in crystallography experiments?

    While specific structural studies on yjjB are not documented in the search results, membrane proteins like yjjB present several challenges for structural determination. Based on general principles of membrane protein structural biology:

    Challenges in Crystallography:

    • Expression and purification of sufficient quantities of homogeneous protein

    • Selection of appropriate detergents that maintain protein stability and allow crystal contacts

    • Conformational heterogeneity, especially in transporters or channels

    • Limited polar surface area for crystal contact formation

    • Phase determination due to low resolution diffraction

    Alternative Structural Approaches:

    1. Cryo-electron Microscopy (cryo-EM):

      • Does not require crystallization

      • Can resolve heterogeneous conformational states

      • Recent advances allow high-resolution structures of smaller membrane proteins

    2. Nuclear Magnetic Resonance (NMR):

      • Solution NMR for specific domains or fragments

      • Solid-state NMR for full-length protein in membrane mimetics

    3. Computational Approaches:

      • AlphaFold2 or RoseTTAFold for structure prediction

      • Molecular dynamics simulations to study conformational dynamics

      • Homology modeling based on structurally characterized homologs

    Experimental Design Recommendations:

    • Screen multiple constructs with varying termini and loop modifications

    • Test a wide range of detergents, lipids, and stabilizing additives

    • Consider lipidic cubic phase (LCP) crystallization for membrane proteins

    • Use thermal stability assays to identify optimal buffer conditions

    • Explore fusion protein approaches (e.g., T4 lysozyme fusion)

  • How can researchers investigate the expression regulation of yjjB under different environmental conditions?

    To thoroughly investigate the regulation of yjjB expression:

    Transcriptional Analysis:

    • Quantitative RT-PCR to measure yjjB transcript levels under various conditions

    • RNA-seq for genome-wide expression analysis including yjjB

    • 5' RACE to map the precise transcription start site(s)

    • Northern blotting to identify potential alternative transcripts or processing events

    Promoter Analysis:

    • Construction of promoter-reporter fusions (e.g., yjjB promoter driving luciferase or fluorescent protein expression)

    • Serial promoter truncations to identify minimal regulatory elements

    • Site-directed mutagenesis of predicted transcription factor binding sites

    • In vitro DNA binding assays (EMSA) with purified transcription factors

    Transcription Factor Identification:

    • Chromatin immunoprecipitation (ChIP) to identify proteins binding the yjjB promoter

    • DNA-affinity purification followed by mass spectrometry

    • Yeast one-hybrid screening against the yjjB promoter

    • Genetic screens for mutants with altered yjjB expression

    Environmental Conditions to Test:

    • Various growth phases (log, stationary, etc.)

    • Nutrient limitation (carbon, nitrogen, phosphate)

    • Stress conditions (pH, temperature, osmotic)

    • Host-relevant conditions (low Mg2+, antimicrobial peptides)

    • Dehydration stress (as examined for other genes in search result )

    This systematic approach would help establish the regulatory network controlling yjjB expression and provide insights into its physiological roles.

  • What bioinformatic approaches are useful for predicting the function of UPF0442 protein yjjB based on sequence and structural features?

    A comprehensive bioinformatic analysis would include:

    Sequence-Based Analysis:

    • Homology searches using PSI-BLAST, HHpred, or HMMER to identify distant relatives

    • Conserved domain identification using InterPro, Pfam, CDD, or SMART

    • Motif searches using PROSITE or MEME to identify functional signatures

    • Evolutionary analysis to identify highly conserved residues (ConSurf, SIFT)

    • Comparative genomics to identify co-evolving genes

    Structural Predictions:

    • Secondary structure prediction (PSIPRED, JPred)

    • Transmembrane topology prediction (TMHMM, TOPCONS)

    • 3D structure prediction (AlphaFold2, I-TASSER)

    • Protein-protein interaction surface prediction (PIER, SPPIDER)

    • Ligand binding site prediction (3DLigandSite, COACH)

    Functional Network Analysis:

    • Protein-protein interaction predictions (STRING)

    • Genomic neighborhood analysis (DOOR2, OperonDB)

    • Co-expression network analysis from public transcriptomic datasets

    • Phylogenetic profiling to identify genes with similar evolutionary patterns

    Integration Approaches:

    • Machine learning approaches combining multiple features

    • Automated function prediction pipelines (SIFTER, ProFunc)

    • Pathway mapping and metabolic network analysis

    These computational predictions should generate testable hypotheses that can be validated experimentally through targeted functional assays.

  • How does post-translational modification affect UPF0442 protein yjjB function, and what techniques are available to study these modifications?

    While specific information about post-translational modifications (PTMs) of yjjB is not available in the search results, a systematic investigation would include:

    Identification of PTMs:

    • Mass spectrometry-based proteomics:

      • Bottom-up proteomics for global PTM identification

      • Targeted approaches for specific modifications

      • Top-down proteomics for intact protein analysis

    • Western blotting with modification-specific antibodies

    • Specialized techniques for specific modifications (e.g., Pro-Q Diamond for phosphorylation)

    Common Bacterial PTMs to Investigate:

    • Phosphorylation (Ser/Thr/Tyr)

    • Acetylation (Lys)

    • Methylation (Lys/Arg)

    • Lipidation (for membrane proteins)

    • S-thiolation, nitrosylation, or glutathionylation (Cys residues)

    Functional Analysis of PTMs:

    • Site-directed mutagenesis of modified residues

    • Phosphomimetic mutations (e.g., Ser to Asp for phosphorylation)

    • Enzymes that add or remove modifications (kinases/phosphatases)

    • Comparative analysis of PTMs under different environmental conditions

    Experimental Design Considerations:

    • Growth conditions may significantly impact the PTM landscape

    • Sample preparation should preserve modifications (phosphatase inhibitors, etc.)

    • Consider enrichment strategies for low-abundance modifications

    • Compare wild-type and stress conditions to identify regulatory PTMs

    Understanding the PTM landscape of yjjB could provide critical insights into its regulation and function in different environmental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.