Recombinant Salmonella schwarzengrund UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Description

Genetic Conservation and Evolutionary Context

The yihY gene shows remarkable conservation across multiple bacterial species, particularly within Enterobacteriaceae. This conservation suggests the protein likely serves a fundamental biological role that has been maintained through evolutionary processes.

Comparison of yihY Across Different Bacterial Species

SpeciesUniProt IDProtein LengthGene NamesSequence Similarity
Salmonella schwarzengrundB4TPN7290 aarbn; yihYReference sequence
Salmonella dublinB5FP16290 aarbn; yihYNearly identical
Salmonella enteritidis PT4B5QWW1290 aarbn; yihY; SEN3815Nearly identical
Escherichia coli O17:K52:H18B7NFI5290 aarbn; yihY; ECUMN_4413High similarity

This conservation extends beyond just the species listed above, as the UPF0761 family has been identified in numerous bacterial genomes, with over 10,144 sequences documented in comprehensive protein databases . The consistent presence of this protein across diverse bacterial species underscores its likely importance in bacterial physiology.

Expression and Purification

Recombinant Salmonella schwarzengrund UPF0761 membrane protein yihY can be expressed using various host systems and purification methodologies, enabling its production for research applications.

Potential Functional Roles

While the specific function of Salmonella schwarzengrund UPF0761 membrane protein yihY remains incompletely characterized, several lines of evidence provide clues about its potential roles.

Ribonuclease Activity

The alternative designation of yihY as ribonuclease BN (rbn) suggests potential enzymatic activity related to RNA processing . This function would be consistent with the protein's conservation across multiple bacterial species, as RNA processing mechanisms are fundamental to bacterial physiology.

Membrane-Associated Functions

As an integral membrane protein, yihY likely plays a role in membrane-associated processes. Bacterial membrane proteins serve diverse functions, including:

  • Transport of molecules across the membrane

  • Signal transduction

  • Maintenance of membrane integrity

  • Participation in virulence mechanisms

The Salmonella genus employs various membrane proteins in its virulence mechanisms, including those involved in adhesion, invasion, and survival within host cells . For example, Salmonella species utilize membrane proteins in type III secretion systems to inject effector proteins into host cells, facilitating bacterial invasion and survival .

Potential Role in Antimicrobial Resistance or Biofilm Formation

Salmonella schwarzengrund has been identified as having multidrug resistance phenotypes and the ability to form biofilms, particularly in isolates from poultry production chains . While there is no direct evidence linking yihY to these processes, membrane proteins often play critical roles in both antimicrobial resistance and biofilm formation, suggesting potential areas for further investigation.

Comparative Analysis with Other Bacterial Proteins

Understanding the potential function of yihY can be enhanced by comparing it with other bacterial membrane proteins whose functions have been better characterized. While not directly homologous to yihY, other bacterial membrane proteins provide insights into the diverse roles these proteins can play.

Comparison with YidC

The bacterial membrane protein YidC, also found in Escherichia coli, functions as a membrane protein chaperone and insertase . Unlike yihY, YidC has been extensively characterized structurally and functionally. YidC contains a hydrophilic groove formed by transmembrane helices, which is essential for its function in membrane protein insertion .

While there is no direct evidence linking yihY to similar functions, the presence of both proteins in bacterial membranes suggests potential functional interactions or complementary roles in membrane protein biogenesis.

Comparison with Virulence-Associated Membrane Proteins

Salmonella species utilize various membrane proteins in their virulence mechanisms. For example, Salmonella injects bacterial proteins such as SopE and SptP into host cells to manipulate host cell functions and promote bacterial invasion and survival . These proteins demonstrate how bacterial membrane proteins can play critical roles in pathogenesis.

Whether yihY contributes to Salmonella virulence remains to be determined, but its conservation across Salmonella serovars makes it an interesting candidate for investigation in this context.

Future Research Directions

Given the limited current knowledge about Salmonella schwarzengrund UPF0761 membrane protein yihY, several promising research directions could elucidate its function and potential applications:

Functional Characterization

Gene knockout studies, complementation assays, and biochemical analyses could help determine the specific functions of yihY. If the protein indeed possesses ribonuclease activity as suggested by its alternative name, RNA processing assays could confirm this function.

Role in Salmonella Pathogenesis

Investigation of potential roles in Salmonella virulence through infection models and comparison of wild-type and yihY-deficient strains could reveal whether this protein contributes to bacterial pathogenesis.

Potential as an Antimicrobial Target

Given its conservation across multiple bacterial species, yihY could represent a novel target for antimicrobial development. Screening for compounds that specifically inhibit yihY function could identify leads for new antibacterial agents.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please specify them when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yihY; SeSA_A4238; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella schwarzengrund (strain CVM19633)
Target Names
yihY
Target Protein Sequence
MLKTVHQKAGRHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA FPMFSDVSIQLRHFIFANFMPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAI DSALNTIWRSKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEADQP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0761 membrane protein YihY and what is known about its structure?

The UPF0761 membrane protein YihY is a membrane-associated protein initially characterized in Escherichia fergusonii but also present in various Salmonella serovars including S. schwarzengrund. Based on computational structure modeling, YihY has a global pLDDT (predicted Local Distance Difference Test) confidence score of 79.89, placing it in the "Confident" prediction category (70 < pLDDT ≤ 90) . The protein consists of approximately 290 amino acids, with varying confidence levels across different regions of its structure .

For structural analysis, researchers typically employ:

  • Computational prediction methods such as AlphaFold

  • Membrane protein isolation techniques using detergent solubilization

  • Circular dichroism spectroscopy to analyze secondary structure elements

  • Targeted mutagenesis to identify functional domains

How does Salmonella schwarzengrund differ from other Salmonella serovars in terms of genetic characteristics?

S. schwarzengrund possesses distinctive genetic characteristics compared to other Salmonella serovars, particularly in its plasmid content and virulence profile. Studies have identified an IncFIB-IncFIC(FII) fusion plasmid that confers streptomycin resistance in approximately 30% of analyzed isolates (17 out of 55) . This fusion plasmid appears to be derived from avian pathogenic plasmids and may confer an adaptive advantage specifically within avian hosts .

Molecular analysis methods for characterizing these differences include:

  • Single Nucleotide Polymorphism (SNP)-based phylogenetic analysis

  • Plasmid profiling and conjugation experiments

  • Whole genome sequencing and comparative genomics

  • PCR-based detection of specific virulence and resistance genes

What experimental systems are available for studying heterologous protein expression in Salmonella?

Several experimental systems are available for heterologous protein expression in Salmonella, particularly in the context of vaccine development:

Expression SystemCharacteristicsAdvantagesLimitations
Balanced lethal systemsUses plasmid vectors encoding protective antigensEnsures plasmid stability post-immunizationMay require specific nutritional supplements
SPI-2 regulated expressionExpression controlled by SPI-2 promotersActivated during intracellular phaseComplex regulation can affect consistency
Constitutive expressionContinuous protein productionSimplifies experimental designMay cause metabolic burden
Inducible systemsExpression triggered by specific signalsOffers temporal controlMay require non-physiological inducers

For optimal expression of recombinant proteins like YihY in Salmonella, researchers should select expression systems that maintain proper protein folding and localization while ensuring plasmid stability during in vivo applications .

How can the immunological properties of recombinant Salmonella schwarzengrund expressing YihY be evaluated in experimental models?

Evaluation of immunological properties requires comprehensive assessment of both innate and adaptive immune responses:

Methodological approach:

  • In vitro assessment:

    • Invasion and persistence assays using human Caco-2 cells to quantify cellular entry and survival

    • Measurement of cytokine profiles (IL-4, IL-10, IL-13) from stimulated macrophages and dendritic cells

    • Flow cytometry to assess antigen presentation via MHC class I and II molecules

  • In vivo assessment:

    • Animal model selection based on research objectives (mice for preliminary studies, target species for application-specific evaluation)

    • Evaluation of mucosal immune responses in gut-associated lymphoid tissue (GALT)

    • Quantification of antigen-specific antibody responses in serum and mucosal secretions

    • Assessment of T-cell responses through ELISPOT or intracellular cytokine staining

Data should be analyzed for both local mucosal responses and systemic immunity, as recombinant Salmonella vaccines induce immune responses at both levels . Researchers should compare wildtype strains with recombinant YihY-expressing strains to determine the specific contribution of this protein to immunogenicity.

What molecular mechanisms explain the interaction between Salmonella-expressed recombinant proteins and host immune system?

The molecular mechanisms underlying immune stimulation by recombinant Salmonella involve multiple pathways:

Live-attenuated Salmonella strains expressing heterologous antigens like YihY cross the epithelial barrier and reach underlying antigen-presenting cells in the mucosa-associated lymphoid tissue (MALT), triggering robust immune responses . During the controlled infection process, they deliver in vivo synthesized antigens directly to B and T lymphocytes in the gut-associated lymphoid tissue (GALT) .

The process follows this sequence:

  • Salmonella targets Peyer's patch M cells, which are specialized for antigen sampling

  • Bacteria remain in membrane-bound vacuoles after cellular entry

  • Within antigen-presenting cells, production of recombinant proteins occurs

  • Antigens are processed and presented via MHC class I and II pathways

  • This triggers both CD4+ and CD8+ T-cell responses

The SPI-2 type III secretion system (T3SS) plays a critical role in this process, as it regulates the translocation of proteins into the cytosol, where they can be processed for MHC class I presentation . This dual presentation via both MHC pathways is key to generating comprehensive immunity.

How do plasmid characteristics affect the stability and expression of recombinant proteins in Salmonella schwarzengrund?

Plasmid characteristics significantly impact both stability and expression efficiency:

Critical plasmid factors affecting recombinant protein expression:

FactorImpact on ExpressionExperimental Verification Method
Replicon typeDetermines copy number and segregational stabilityPlasmid stability assays in absence of selection
Promoter selectionControls expression timing and levelqRT-PCR for transcript quantification
Origin of replicationAffects plasmid compatibility and maintenanceCompetitive growth experiments
Size of insertLarger inserts may reduce stabilitySerial passage experiments
Fusion partnersMay enhance expression or solubilityWestern blot analysis

Experimental evidence indicates that fusion plasmids in S. schwarzengrund do not significantly enhance invasion and persistence potential in human Caco-2 cells , suggesting that while they may provide advantages in avian hosts, their direct contribution to mammalian virulence may be limited.

What are the optimal methods for detecting and quantifying membrane localization of YihY in recombinant Salmonella constructs?

Determining membrane localization of YihY requires multiple complementary approaches:

Recommended methodological workflow:

  • Subcellular fractionation:

    • Differential centrifugation to separate cellular components

    • Sucrose gradient ultracentrifugation for membrane isolation

    • Western blot analysis of fractions using anti-YihY antibodies

  • Fluorescence microscopy:

    • Construction of YihY-GFP fusion proteins

    • Live-cell imaging to visualize localization patterns

    • Colocalization studies with known membrane markers

  • Protease accessibility assays:

    • Treatment of intact cells with proteases that cannot cross membranes

    • Analysis of proteolytic fragments to determine exposed domains

    • Comparison with standard membrane protein controls

  • Membrane topology mapping:

    • Cysteine scanning mutagenesis with thiol-reactive probes

    • PhoA/LacZ fusion reporter systems at various positions

    • Computational analysis validated by experimental data

When analyzing results, researchers should consider that the UPF0761 membrane protein YihY has regions of varying structural confidence, with some portions potentially adopting different conformations depending on the lipid environment .

How can genetic modification systems be optimized for recombinant expression of YihY in Salmonella schwarzengrund?

Optimizing genetic modification systems requires consideration of multiple factors:

Strategic approach:

  • Selection of appropriate attenuation strategy:

    • Metabolic gene deletions (aroA, purA) for controlled growth limitation

    • Virulence gene modifications (phoP/phoQ) for reduced pathogenicity

    • Regulatory mutations affecting stress responses and colonization

  • Vector design considerations:

    • Incorporation of balanced lethal systems to ensure plasmid maintenance without antibiotic selection

    • Codon optimization of yihY gene for Salmonella expression

    • Selection of promoters that activate under appropriate conditions in vivo

  • Transformation protocol optimization:

    • Evaluation of electroporation versus chemical transformation efficiency

    • Identification of strain-specific transformation barriers

    • Development of specialized protocols for S. schwarzengrund isolates

Based on research with other Salmonella recombinant systems, the expression of heterologous antigens under SPI-2-regulated conditions provides an optimal balance between immunogenicity and attenuation , making this a promising approach for YihY expression.

What analytical techniques provide the most accurate assessment of YihY protein structure-function relationships?

Structure-function analysis of YihY requires integration of computational and experimental approaches:

Comprehensive analytical framework:

  • Computational structure prediction:

    • AlphaFold modeling as demonstrated for E. fergusonii YihY (confidence score 79.89)

    • Molecular dynamics simulations to assess structural stability

    • Prediction of potential functional sites and interaction interfaces

  • Site-directed mutagenesis:

    • Alanine-scanning mutagenesis of predicted functional residues

    • Conservative and non-conservative substitutions at key positions

    • Analysis of mutant phenotypes in relevant assays

  • Functional characterization:

    • Protein-protein interaction studies (pull-down, Y2H, FRET)

    • Membrane association assays (liposome binding, detergent extraction)

    • Functional complementation of yihY deletion mutants

Researchers should note that while computational models provide valuable structural insights, experimental validation is essential, particularly for membrane proteins whose functions may depend on specific lipid environments or protein-protein interactions not captured in silico.

How does the virulence profile of recombinant Salmonella schwarzengrund compare across different host systems?

Analysis of virulence across host systems reveals important context-dependent variations:

Comparative host system analysis:

Studies of S. schwarzengrund isolates containing the IncFIB-IncFIC(FII) fusion plasmid show distinct patterns between food (primarily poultry) and clinical isolates. While phylogenetic analysis suggests the plasmid may confer advantages specifically within avian hosts, its impact on mammalian pathogenicity appears more limited .

Host SystemVirulence CharacteristicsExperimental ModelsKey Findings
AvianPotential extraintestinal spreadChicken infection modelsFusion plasmids may be associated with host-specific advantages in birds
Human (intestinal)Invasion of intestinal cellsCaco-2 cell cultureClinical and food isolates show similar invasion rates regardless of plasmid presence
Human (extraintestinal)Potential systemic spreadClinical isolate analysisSome plasmid-bearing strains found in urine and gallbladder, suggesting possible role in extraintestinal infection

When designing recombinant Salmonella expressing YihY, researchers should consider that virulence attenuation must be carefully balanced with immunogenicity. Too much attenuation can reduce vaccine efficacy, while insufficient attenuation raises safety concerns .

What are the most effective strategies for designing recombinant Salmonella schwarzengrund constructs as potential vaccine vectors?

Designing effective recombinant Salmonella vaccine vectors requires strategic considerations across multiple dimensions:

Optimal design approach:

  • Attenuation strategy selection:

    • Deletion of critical metabolic genes (aroA, aroC, purA) that limit in vivo growth

    • Mutation of two-component regulatory systems (phoP/phoQ) controlling virulence

    • Introduction of regulated delayed attenuation systems for improved immunogenicity

  • Antigen expression optimization:

    • Selection of appropriate promoters (constitutive vs. in vivo-induced)

    • Codon optimization for maximal expression in Salmonella

    • Consideration of subcellular localization (cytoplasmic, periplasmic, surface-displayed, or secreted)

  • Plasmid stability enhancement:

    • Implementation of balanced lethal systems ensuring plasmid maintenance without antibiotics

    • Selection of compatible plasmid backbones with optimal copy number

    • Inclusion of post-segregational killing systems for additional stability

Recombinant live-attenuated Salmonella vaccines (RASVs) have demonstrated efficacy against bacterial, viral, and parasitic pathogens, making them particularly suitable for veterinary applications . For S. schwarzengrund specifically, the natural presence of IncFIB-IncFIC(FII) fusion plasmids in certain isolates suggests these elements may provide a foundation for vector development, particularly for poultry applications .

How can researchers address challenges in immune response variability when using recombinant Salmonella expressing YihY?

Addressing immune response variability requires systematic investigation of contributing factors:

Methodological solutions to variability:

  • Strain selection considerations:

    • Screening multiple S. schwarzengrund isolates for optimal immunogenicity profile

    • Comparing plasmid-bearing vs. plasmid-free backgrounds to assess contribution to response

    • Analysis of genetic stability across passage in vitro and in vivo

  • Host factors assessment:

    • Evaluation of age-related immune response differences

    • Investigation of prior exposure effects on vaccine efficacy

    • Analysis of genetic background influence on response magnitude

  • Formulation and delivery optimization:

    • Comparison of different administration routes (oral, intranasal, intraperitoneal)

    • Assessment of dose-response relationships for optimizing protocols

    • Investigation of adjuvant co-administration effects

Studies with recombinant Salmonella vaccines have demonstrated variable levels of fecal shedding and immune response, highlighting the need to test different vectors to achieve optimal balance among immunogenicity, stability, and biocontainment . Researchers should implement standardized immunological readouts to facilitate comparison across experiments.

What analytical frameworks best capture the complex interactions between recombinant Salmonella schwarzengrund and host immune systems?

Comprehensive analysis of host-pathogen interactions requires integration of multiple analytical approaches:

Integrated analytical framework:

  • Transcriptomic analysis:

    • RNA-seq of host cells following exposure to recombinant Salmonella

    • Bacterial transcriptome analysis under different host conditions

    • Identification of key regulatory networks activated during infection

  • Immunological profiling:

    • Multi-parameter flow cytometry to characterize immune cell populations

    • Cytokine/chemokine profiling using multiplex assays

    • T-cell receptor and B-cell receptor repertoire analysis

  • Systems biology integration:

    • Network analysis of host-pathogen interaction data

    • Computational modeling of immune response dynamics

    • Machine learning approaches to identify predictive biomarkers of protection

Research on Salmonella immune interactions shows that these bacteria efficiently target mucosa-associated lymphoid tissue (MALT) and induce both local and systemic immunity . The capacity to stimulate both MHC class I and II pathways makes recombinant Salmonella particularly effective for inducing comprehensive immunity, including both antibody and T-cell responses .

How might comparative analysis of YihY across Salmonella serovars inform optimization of recombinant expression systems?

Comparative analysis across serovars could reveal important evolutionary and functional insights:

Research strategy:

  • Phylogenetic analysis of YihY protein sequences:

    • Identification of conserved domains suggesting functional importance

    • Detection of serovar-specific variations that might confer specialized functions

    • Correlation of sequence variations with host adaptation patterns

  • Expression profiling across conditions:

    • Transcriptomic analysis of yihY expression under different environmental stresses

    • Proteomic quantification in various growth phases and conditions

    • Investigation of regulatory networks controlling expression

  • Structure-function comparisons:

    • Modeling of YihY variants from different serovars to identify structural differences

    • Functional complementation studies across serovars

    • Assessment of membrane integration efficiency in heterologous systems

The current data on UPF0761 membrane protein YihY structure from E. fergusonii (confidence score 79.89) provides a starting point, but comparative analysis across Salmonella serovars would enhance understanding of potential functional specialization and expression optimization strategies.

What emerging technologies could advance research on recombinant Salmonella schwarzengrund membrane proteins?

Several cutting-edge technologies show promise for advancing this research area:

Emerging methodological approaches:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for high-resolution membrane protein structures

    • Hydrogen-deuterium exchange mass spectrometry for dynamics analysis

    • In-cell NMR for structural characterization in native environments

  • Genetic engineering advancements:

    • CRISPR-Cas9 systems optimized for Salmonella engineering

    • Synthetic biology approaches for rational design of attenuated strains

    • Multiplexed genome engineering for combinatorial strain optimization

  • Single-cell analytical methods:

    • Single-cell RNA-seq of host responses to recombinant Salmonella

    • Live-cell imaging with advanced biosensors for real-time interaction tracking

    • Spatial transcriptomics to map host-pathogen interactions in tissues

These technologies could particularly enhance understanding of how membrane proteins like YihY integrate into bacterial membranes and interact with host cellular components, potentially revealing new strategies for vaccine development and therapeutic interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.